Commit 6b722927 authored by Raquel Bromberg's avatar Raquel Bromberg

REFS and Examples added

parent ecf11784
>gi|154147865|ref|YP_001405618.1| hypothetical protein CHAB381_A0001 [Campylobacter hominis ATCC BAA-381]
MIYYPQNSILKKPQSFAELRGKYCQKGANMRKHTKHLLLKLYLNFRLFKLKVEVEIRK
>gi|154147864|ref|YP_001405619.1| putative RepE [Campylobacter hominis ATCC BAA-381]
MRLGSRQERGRKSPPFGSIKQSKGDKMAKLPVYYDNKMNLLAFKNLDKVEANLFFSIVARFNDKGAEKLK
LNFSEIAEFISDNKYTSKELSKLINDGVGKVVQSAIKWEMTPIKTAYFTLFNEFLVDDENKTLEASINSR
FLFMLNNFKDGNFTMLELAEFSSLKSKYTQTLYRLLKQFRFTGFRSIKWAEFIEIMDIPTSYRARDIDKQ
ILKPAIAELTQEADIFNQNNPIFKKLIYKKIRGTGRGRPVELIEFYFMPETDEPKEQKKNEKALQYIAQD
IKKEQMLKELKRSSQEPKKINPLTGQEITGLEPYRLRNMRFKNKFGEYDILKIQNIEQEPSGKIIVTVRN
VDDNHISTMKFDSLKHFENTFNLHQM
>gi|154147862|ref|YP_001405620.1| hypothetical protein CHAB381_A0003 [Campylobacter hominis ATCC BAA-381]
MRVLLSKRSVRQRVTSPYDLNFSIIFAFLERFPFNIFLNLTFNLLDPFLASAWWWFAWVFRG
>gi|154147861|ref|YP_001405621.1| hypothetical protein CHAB381_A0004 [Campylobacter hominis ATCC BAA-381]
MKSYKSIRKTIRFTDDEFSTIKEKMELGNYSNFTEFALHSMINKKPSKAKSINKEYLLELNRIGNNLNQL
TRKLNKGDRLNNLSLSAIIDIRDSINSLKEKI
>gi|154147863|ref|YP_001405622.1| mobilization protein [Campylobacter hominis ATCC BAA-381]
MIVKFFNTKKGGGNSAIDYLLDKRVEQGTSRILQGDEQLTRDIIKNMSQKHKTCVGVLSFEEKDIDEQLK
FKLMADFEKALMTDEAQGRYNILWVEHNDKGRLELNFVIPKIDLQTKKALNPYYHNADLSRIASWQDIKN
IEYNFKNPKDPSKEQTIQGSKKQVEIYKDYEKLDNFLQQEVKNGTLQSRAEIIKLLQDNGVEVTRQGKDY
LSIKLPDNTKAKRFKGGIYSDEFRSIESIRTIGDEQKEREREFSQRDNTAELERLRNQFERAYNAKSKYY
KREFEKRDRQHKNRYDNYRTGIDEFKANEHKADNFIDNSISSDFFSPISETSRSDIDDSVRNRIDERARQ
LREREQEAIRTAKRTRADYKPTQKEPIRLNEREYALLADNRKQQQEPIIDENYIREREKRKREAIKRIRE
LREARERQRNTELEASIKPSFERLREVREGIKQQHERHTIFADIFRQSEASFRKHITGRIQEFGRQFQRN
ITEFGETLREQGKRSIKSGIDEVRAFINKHKRELERVLEKGKTKA
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
>gi|299883475|ref|YP_003739026.1| hypothetical protein HacjB3_19498 [Halalkalicoccus jeotgali B3]
MNIIQLTGISLPVLLGILAYYGKHIGGEPDEITPLTDDLSLDSKEATRALYLIFFSVWVLLGSAYFLSFM
VLATHFHIVHPIILALSAYGLFIAILSFSVPIVLGTPLRGHFHRMLALLLALLFSMFSILFSLILFIFIA
NTIPIPQSLEDLYIFSFISINALAIVIFVMLAVLVPWENYSSRGEIAWLFYFRSVKESIRSGNFFLRSDG
DSTDKTDIPYYQ
>gi|299883476|ref|YP_003739027.1| hypothetical protein HacjB3_19503 [Halalkalicoccus jeotgali B3]
MPAENDPPTDAPRDLAEDIHQFLKDIDEPQAVYEKMQVGEFDEAFEKTTEECPYERTHMLI
>gi|299883477|ref|YP_003739028.1| hypothetical protein HacjB3_19508 [Halalkalicoccus jeotgali B3]
MPTASPLQHQRELDELPLYLPEQNAVLVGRIIDDESEMAGMAAYYVHWRGGVYIGNYNEADNAFTSHYST
KLEERMMSHQVKAFDDMEVEKELSSIGEALLDAYDFAETQAMADKQAHVFALQSMNGFTRSQTANILNVS
PSTVDSQRASATKKADAAVAFTATYTEKKENPDNEDLLKH
>gi|299883478|ref|YP_003739029.1| hypothetical protein HacjB3_19513 [Halalkalicoccus jeotgali B3]
MQKKKQKITYFSTQLLDTQTSTSPENLDIFCHLPEKSNLTLLRTTFLLIKQLQCWHTKLDTHSTLE
>gi|299883479|ref|YP_003739030.1| hypothetical protein HacjB3_19518 [Halalkalicoccus jeotgali B3]
MKIAAEWVQFEIPYLLQVEDSFEGNESARFHSRVRGVPAELQFKKEAREGEEGERPGMMFGQVEGDRLGN
VSYTKVRVGFNRQLLDALPDELNGDFEALKEGSPTKWLKNLDGREGRIIRAAVDQVNQFLEVYRASLGYY
WIRGVSPSEVVYFMRTTVSKNEDTYDHGTMYPGSALTPGTSTIDEKAHDTIEARLDTEHKVPITISLRLD
AQDKLDLGEYRLAVITAGTMFEAFLKDGLKDLMAAQGMSDDEIESVFVDDGDYTSITTLAKETVPKTIHF
DFKETDQFEAWDEETRKMRNRVVHEGYVPSEDEARAAYEAAADAVEFLTDKMVERHEELSN
>gi|299883480|ref|YP_003739031.1| hypothetical protein HacjB3_19523 [Halalkalicoccus jeotgali B3]
MAEEESEFWSPTVPSDDTPIWRYRDLSQFLSILEKQSLWFNRADLFSDPFEGSFAKANVETRQFRYAQTE
IPNDVLETMSVMAKKFRKTTYLNCWHINTHESAAMWDLYLPADKGIAIRSTVGRFREAINESDNDAKIEI
DTDDDEVEELDAIMKIGKVNYIDYSSKLIPESNSFAPLYHKRKSYEHENEFRASFSKFGDMLELQGGLRP
DADFATAPGHNVEVDLSKLIESVYVAPSAPNWFFEVLESVTDRYDIDIQIQQSDLDDDPVF
>gi|299883481|ref|YP_003739032.1| hypothetical protein HacjB3_19528 [Halalkalicoccus jeotgali B3]
MTDYSFSAEYKDSLFDESGNLTYNNSRFKGEPVDLSEDSEGEENDDDDGTMTFATNTEDIDDNESETEKS
DEKLFQRRLERKERIDKQKKSHRTENKPHDSHDKTSLEPDSDSWSEILAMYENDDFGDTKKADYRAAEKL
VEEYHIKTLESSEEVFWYDESEGTYKENGGKKVDKVLNDRLKWLCDNRTKGEVKSRLQSMSWVMEDTVFN
PPEGFICVKNGVLNLTDPDNPELEDHSPEYGFRKNMDTPYIEGAENQLFVDSLEETVQDKDLEKLQEYTG
IALEDWEQPTKMAVLIGPQNAGKGTYLHAIESIFGKGNVAAEPIKELADSRWSTNSLKDRPLNIANELST
EKVNHQEAVKTLTGGGDSKRAEDKGDSVYEFIPTSNHLFATNQLPEMPGADGIFYNRFLFVDFPQTVPKE
DRDASLDEKMVESEQRRAGILNWLIEGYARIKSRGKTGYTNELSEADKISKWHSYGSSIERFIETCIETD
EAVEDDARTKKDLYQTYLRMSKDANLPCKAQATLTGKLKKLPGVREYRGYQENVDNPYFDETARPDSLRG
IDFTNIGNEYFWDAVESDTPEMEDMVEGDNQTRESF
>gi|299883482|ref|YP_003739033.1| hypothetical protein HacjB3_19533 [Halalkalicoccus jeotgali B3]
MSEHRTTVRLEDKHKEFLDEVEVINLAGFVREKLNEEMEKRDYSPE
>gi|299883483|ref|YP_003739034.1| hypothetical protein HacjB3_19538 [Halalkalicoccus jeotgali B3]
MAKSKQNTKFRKSVLIEEEQEKFLREEQGFNFSGFVRKSLYEEMKKRGYDPK
>gi|299883484|ref|YP_003739035.1| hypothetical protein HacjB3_19543 [Halalkalicoccus jeotgali B3]
MTLRDFVSQFHGLKTKADEIVEDIDNSEITEDVLKRVYEDACELTTERSESGLDETIGSIGTDLETRLHA
YVGDGPETIVEQIDREGYDDIDDITVYYQAGGSYDEGNKTVPFCFELAAVPTWITGKNERAGSKHILGIN
QSVLYDGGFVHLHSPLSEGASSFDTSFNGNHQYVVVANIYCPNVGFRDKGKQGFNSEPFERVISEVVGKA
KRKIERDIRPRLNDLREEEQEETLSGKAPNGFIKDFVWDNFWDVYNDATDNGTYSIEMRQLYYKFRPLFL
DEAEKRGYQYSTKATVDDPKPLELNFDTFSDYISEFEEEELGERLIIRDERGFFVEPHTNQRINLGTTAV
RQYDPSDVDYGDILFIEKTGFMDILHREFELTKKYDIGLINSKGWNTTAGQKLVEKIQTANPDATLYVLS
DLDIAGVGIADNVSSPDELSDLDELATEKIGVTCDDVHEYGLPAEKGEYKDKTLSQLETMHDDGIVDDET
YEYLGEDNRVEINAFSPVELKEYLETKFEDHDITKQYPSPSVINEPDLPDSTETRSTAIEQALGRWVMAQ
IPDDMVERIEDSVTVDDALTGQLEDLETDPKSLTEEIHEELADNPPRHWSDMNEELVEKREKEAEEASED
YIETVSESTKEYLDENHTVEFE
>gi|299883485|ref|YP_003739036.1| hypothetical protein HacjB3_19548 [Halalkalicoccus jeotgali B3]
MVIHNFQTIIATTVTKFDCYTKSRHIRWPVFRDFNMILPKFLSSVNCISLFLGMDDQRLVPIDYVLDTED
AHQSIALIATGWECIMALRTDEIIYITEDIMNGSLINSGAIIIDANLRYVGITVGVLLCFYFYRNTHPIR
CFKGVIDKLLQAVDTPMRRGLSGYCL
>gi|299883486|ref|YP_003739037.1| hypothetical protein HacjB3_19553 [Halalkalicoccus jeotgali B3]
MMTWLLVAGILVTNCYLSALLIEELLTVLART
>gi|299883487|ref|YP_003739038.1| polysaccharide deacetylase [Halalkalicoccus jeotgali B3]
MKGRRPTRRGVLQNVFGIGLFSWFISKIKQLFGVQSDSGRKSPEEMTTENKPLHADQEQAKEPKEEEEDP
QPTLPENGAIVFVYDDGAMEDYTQALPAHKAFDAPATTGIVSEWVGTSGYMDTEELDELVEAGWEIASHT
KEHRPLASFPLTEDTNHSDTIVSAEGYRHGHHEGETVEITDGETKVLREIAGLAGEPGERRVKLTEPVDE
HFHAGETEIHYPAAVMHEAVDDSKKALEEMGYDVSTILAPYDVYSGYSNLFVKEQYDGVANAEHGSRINH
PDEYDPYETQRDYFIEFTDKKSVKHDLDKIADDALLGVVGAHSFKDEVNEESIQEMLEWVEERDIETMTL
REAIETYD
>gi|299883488|ref|YP_003739039.1| SWIM zinc finger domain protein [Halalkalicoccus jeotgali B3]
MVGQANEKTLKRAQWESFSFELEAPGLVRVTNDSYDEDGHSYTVNVETDVPVACECKAFEYQDGPCKHMV
AVAIREPVLMAAQAVPIPDGGQAKNTCQNGQTGCCGPHGDELPCFDCYQDRR
>gi|299883489|ref|YP_003739040.1| hypothetical protein HacjB3_19568 [Halalkalicoccus jeotgali B3]
MNEKKEYMSNAGRKPRVTDDELIDTIRQLTDTNENIVVTTPEITDELPIAQRSVYDRLIKLNDEERVQKK
KVGARAIVWWVNADE
>gi|299883490|ref|YP_003739041.1| hypothetical protein HacjB3_19573 [Halalkalicoccus jeotgali B3]
MTATVEQLQTEYDSIWEAVAEERRAREKLETENEELRAELEKQDEQIEQNAEHIEQVDAKAENNNDGWSL
DHRPTSETEHLDALWLTHTEEEIPDQPLGRIVNGARSKADSNATEIRDIALDRIDPDDYLERTGGMDPNE
MIDLHRHHQVQKGDSIADGPFSNEANTARAALLFPRLREMSRGLQGGAREICAKDLADEIRRSFANDPER
KAELADPAENANTAQRILRRCARFGGDLMHFDVAENRLLIDADEWREYSRKSQQAFDGETDPDAENVIGG
GDTESYSVVNNDQR
>gi|299883491|ref|YP_003739042.1| hypothetical protein HacjB3_19578 [Halalkalicoccus jeotgali B3]
MSHTSDITSGDGTDTGETIEAQQQAIDDLQKRIEELEKAVQTRTERYTILRDIVTKKTDLDSETIDELVE
RQLESDDR
>gi|299883492|ref|YP_003739043.1| hypothetical protein HacjB3_19583 [Halalkalicoccus jeotgali B3]
MRQMTVSLREEQARWVESKVGDSSDHQSKSAVIRFIIDDHQDRNEELVELQRKREELENKVQRLQNEKKL
ILQQREEHTELVESIQREQTMAERKNKAGVATRFKWWLTGMPDE
>gi|299883493|ref|YP_003739044.1| hypothetical protein HacjB3_19588 [Halalkalicoccus jeotgali B3]
MSGRLPQTTVLDATVLSNYATSGSVEYLIDILPRAMVVTTVREELQQGYNAGYEFLGDALDLIVSDKPDD
EYDIRDNTVIHLKRIHSSREKIDSNLDPGEADSLYHALINGRVLATDDRDARQLARELDVPVTGSLGILV
RGIKQDKITVSTANEWLSEWQDAGYHSPVDDMRELSDKYTE
>gi|299883494|ref|YP_003739045.1| hypothetical protein HacjB3_19593 [Halalkalicoccus jeotgali B3]
MCPSSLETAGKDKDLATIIGLYVLEELTLGQAAERLEISRFEMREILHEGGVELRLGPKDIDDASSEIDV
ALNLE
>gi|299883495|ref|YP_003739046.1| hypothetical protein HacjB3_19598 [Halalkalicoccus jeotgali B3]
MILDSLLQNFMMRSCLMRNSAAPISIERSSKALISLVRTLLSTLLVGLTILAQSSMILTYFMRIFVVLNS
LTWCFATRISLEVIILTLTLEMLILVMQHFIMRFSHALIVAERHLPMLYFMRRFLQMLGLTRKRHSMIQA
FLDQWLSMKKTHMLWKDCPWILIH
>gi|299883496|ref|YP_003739047.1| hypothetical protein HacjB3_19603 [Halalkalicoccus jeotgali B3]
MLLFQEQDSMTLAFATHSSIMLNFLKQNSIMPTSPTHDSSMLNSLNQIFIMLNSF
>gi|299883497|ref|YP_003739048.1| hypothetical protein HacjB3_19608 [Halalkalicoccus jeotgali B3]
MDDTARDLAKDIHQFLNDVDNPQAVYNKMQAGEFDEAFAMMGLTRNQAESIARSWHTRIRTILRQTVRD
>gi|299883498|ref|YP_003739049.1| hypothetical protein HacjB3_19613 [Halalkalicoccus jeotgali B3]
MGDYMVTIRVSIFYPALWLLLVIHVLIVGVDDNGLCFGEVKWFSVYLSSRY
>gi|299883507|ref|YP_003739050.1| hypothetical protein HacjB3_19618 [Halalkalicoccus jeotgali B3]
MTKPDETDADAANSAETNGATDMDDNADPNETSFVGTDVLTVAKDAVKAKRGHGGISEVIRDAINREAFG
EQLNRRGQLEARREELVEKRAERREELREVTNRLEGEIDALGDEIDTLDTKLNSLTTREERYEAKLESLE
YWLRVKGMRFDPGNGRLKEVAASAGREPEGVIQDLKLRNPDVPDVAFGDGDPGDTYNPPDSNQTALKSTE
STGGDGEITPLRDREEIYREREPATETEPGTEPELIGDGSGDTQDNRPNNPDE
>gi|299883500|ref|YP_003739051.1| hypothetical protein HacjB3_19623 [Halalkalicoccus jeotgali B3]
MATNMRYLNGSNTDESSITTNATPNASVVVRRTPDEMDANRGRERHPDAPRPPGNHPTAVRGLDPETGRA
VWIDFGEDGGAEIVGPVVLPDGTLPDREPGAVGNRESAATATEPDRESPPGAIETAIGSDRLATLASVNP
GRLGKLAGLDIGADRDTEANTEPDRESPTTESHRRASPVTGTLTALSPVKGVGSTDDTDANTESDTESNE
DTERVGPDRVGAPTLAAYREAHADAESTDGEGDR
>gi|299883501|ref|YP_003739052.1| hypothetical protein HacjB3_19628 [Halalkalicoccus jeotgali B3]
MSASARRHTDAELLRYAAQVSSEHGEPFSASSMAPKTDLSTDDLADQLLALSLDYETPASRRGKRDSYLP
LRSVRVAGERVWFLAPPDEIERTDRLTGVRQAAILHKGDDLRVGSLNTQSLHGNRAWEPDRGDRRATELL
AEHAPEWWREAADE
>gi|299883502|ref|YP_003739053.1| hypothetical protein HacjB3_19633 [Halalkalicoccus jeotgali B3]
MTTHDIDISDDTSGKDAEISDIVSGIETCDRMIEMAESRLNGRIRNAEHERIRIQYIKAISTHLRTKRSY
LKDRELEEMAETVADLEREIGRP
>gi|299883503|ref|YP_003739054.1| hypothetical protein HacjB3_19638 [Halalkalicoccus jeotgali B3]
MSRDDREDLRRRIEELRDRAGERPDLIEALGIERAAEWWFDPDTQKRMIQSSLGGSQRPQAVVTTSEGEE
YRADLIALWTGVVSSQDPDEIIEETEASG
>gi|299883504|ref|YP_003739055.1| hypothetical protein HacjB3_19643 [Halalkalicoccus jeotgali B3]
MLQDLSIFFEFSELAVHCLPSAADLIGHLLRGLRSRHSIPSPEDTENPFFSDLFSVPAVFGSLAFHGWMY
SSLLYIPVAH
>gi|299883505|ref|YP_003739056.1| hypothetical protein HacjB3_19648 [Halalkalicoccus jeotgali B3]
MQSITIKLSSETIDSLNSIAEAEHDGNRSDAVRELLSKGMDYDALEARHKEAQQQLRAVNARQEDVGELV
EHVERERELQQRERERRDAPIWQRAKWWVLGRS
>gi|299883506|ref|YP_003739057.1| hypothetical protein HacjB3_19653 [Halalkalicoccus jeotgali B3]
MNVINNYAWFPGPMEREQYWLENIYYVVRIVYVVILIAGTLSVLGGV
This source diff could not be displayed because it is too large. You can view the blob instead.
>gi|76789624|ref|YP_328709.1| virulence plasmid integrase pGP7-D [Chlamydia trachomatis A/HAR-13]
MGSMAFHKSRLFLTFGDASEIWLSTLSHLTRKNYASGINFLVSLEILDLSETLIKAISLDHSESLFKIKS
LDVFNGKVVSEASKQARAACYISFTKFLYRLTKGYIKPAIPLKDFGNTTFFKIRDKIKTESISKQEWTVF
FEALRIVNYRDYLIGKLIVQGIRKLDEILSLRTDDLFFASNQISFRIKKRQNKETKILITFPISLMEELQ
KYTCGRNGRVFVSKIGIPVTTSQVAHNFRLAEFHSAMKIKITPRVLRASALIHLKQIGLKDEEIMRISCL
SSRQSVCSYCSGEEVSPLVQTPTIL
>gi|76789625|ref|YP_328710.1| virulence plasmid protein pGP6-D [Chlamydia trachomatis A/HAR-13]
MNKLKKEADVFFKKNQTAASLDFKKTLPSIELFSATLNSEESQSLDRLFLSESQNYSDEEFYQEDILAVK
LLTGQIKSIQKQHVLLLGEKIYNARKILSKDHFSSTTFSSWIELVFRTKSSAYNALAYYELFINLPNQTL
QKEFQSIPYKSAYILAARKGDLKTKVDVIGKVCGMSNSSAIRVLDQFLPSSRNKDVRETIDKSDSEKNRQ
LSDFLIEILRIICSGVSLSSYNENLLQQLFELFKQKS
>gi|76789626|ref|YP_328711.1| virulence plasmid ParA family protein pGP5-D [Chlamydia trachomatis A/HAR-13]
MGCNLAQFLGKKVLLADLDPQSNLSSGLGASVRSNQKGLHDIVYTSNDLKSIICETKKDSVDLIPASFLS
EQFRELDIHRGPSNNLKLFLNEYCAPFYDICIIDTPPSLGGLTKEAFVAGDKLIVCLTPEPFSILGLQKI
REFLSSVGKPEEEHILGIALSFWDDRNSTNQMYIDIIESIYKNKLFSTKIRRDISLSRSLLKEDSVANVY
PNSRAAEDILKLTHEIANILHIEYERDYSQRTT
>gi|76789627|ref|YP_328712.1| virulence plasmid protein pGP4-D [Chlamydia trachomatis A/HAR-13]
MQNKRKVRDDFIKIVKDVKKDFPELDLKIRVNKEKVTFLNSPLELYHKSVSLILGLLQQIENSLGLFPDS
PVLEKLEDNSLKLKKALIMLILSRKDMFSKAE
>gi|76789628|ref|YP_328713.1| virulence plasmid protein pGP3-D [Chlamydia trachomatis A/HAR-13]
MGNSGFYLYNTENCVFADNIKVGQMTEPLKDQQIILGTTSTPVAAKMTASDGISLTVSNNSSTNASITIG
LDAEKAYQLILEKLGDQILDGIADTIVDNTVQDILDKIKTDPSLGLLKAFNNFPITNKIQCNGLFTPSSI
ETLLGGTEIGKFTVTPKSSGSMFLVSADIIASRMEGGVVLALVREGDSKPCAISYGYSSGVPNLCSLRTS
ITNTGLTPTTYSLRVGGLESGVVWVNALSNGNDILGITNTSNVSFLEVIPQTNA
>gi|76789629|ref|YP_328714.1| virulence plasmid protein pGP2-D [Chlamydia trachomatis A/HAR-13]
MVNYSNCHFIKSPIHLENQKFGRRPGQSIKISPKLAQNGMVEVIGLDFLSSHYHALAAIQRLLTATNYKG
NTKGVILSRESNSFQFEGWIPRIRFTKTEFLEAYGVKRYKTSRNKYEFSGKEAETALEALYHLGHQPFLI
VATRTRWTNGTQIVDRYQTLSPIIRIYEGWEGLTDEENIDIDLTPFNSPSTRKHKGFVVEPCPILVDQIE
SYFVIKPANVYQEIKMRFPNASKYAYTFIDWVITAAAKKRRKLTKDNSWPENLLLNVNVKSLAYILRMNR
YICTRNWKKIELAIDKCIEIAIQLGWLSRRKRIEFLDSSKLSKKEILYLNKERFEEITKKSKEQMEQLEQ
ESIN
>gi|76789630|ref|YP_328715.1| replicative DNA helicase [Chlamydia trachomatis A/HAR-13]
MKTRSEIENRMQDIEYALLGKALIFEDSTEYILRQLANYEFKCSHHKNIFIVFKYLKDNGLPITVDSAWE
ELLRRRIKDMDKSYLGLMLHDALSNDKLRSVSHTVFLDDLSVCSAEENLSNFIFRSFNEYNENPLRRSPF
LLLERIKGRLDSAIAKTFSIRSARGRSIYDIFSQSEIGVLARIKKRRAAFSENQNSFFDGFPTGYKDIDD
KGVILAKGNFVIIAARPSIGKTALAIDMAINLAVTQQRRVGFLSLEMSAGQIVERIIANLTGISGEKLQR
GDLSKEELFRVEEAGETVRESHFYICSDSQYKLNLIANQIQLLRKEDRVDVIFIDYLQLINSSVGENRQN
EIADISRTLRGLASELNIPIVCLSQLSRKVEDRANKVPMLSDLRDSGQIEQDADVILFINRKESSSNCEI
TVGKNRHGSVFSSVLHFDPKISKFSAIKKVW
>gi|76789631|ref|YP_328716.1| virulence plasmid integrase pGP8-D [Chlamydia trachomatis A/HAR-13]
MGKGILSLQQEMSLEYSEKSYQEVLKIRQESYWKRMKSFSLFEVIMHWTASLNKHTCRSYRGSFLSLEKI
GLLSLDMNLQEFSLLNHNLILDAIKKVSSAKTSWTEGTKQVRAASYISLTRFLNRMTQGIVAIAQPSKQE
NSRTFFKTREIVKTDAMNSLQTASFLKELKKINARDWLIAQTMLQGGKRSSEVLSLEISQICFQQATISF
SQLKNRQTEKRIIITYPQKFMHFLQEYIGQRRGFVFVTRSGKMVGLRQIARTFSQAGLQAAIPFKITPHV
LRATAVTEYKRLGCSDSDIMKVTGHATAKMIFAYDKSSREDNASKKMALI
>gi|384519688|ref|YP_005706991.1| hypothetical protein EF62_pA0001 [Enterococcus faecalis 62]
MKKLLVLILGVSFISVALSSTTEASAREWDSIECQPGFYWKKGGWTAGGYHKAGGFCIPMHTRWTK
>gi|384519689|ref|YP_005706992.1| hypothetical protein EF62_pA0002 [Enterococcus faecalis 62]
MKKYLIKNIFYITIPLVLSYITSFLVNIDLPILIIIFYGILLFFLIPSEVYLGSTMDYNAKVVNPTYRPE
NKSFEDSPKSKILSILIVLLCLILTISIWYFSN
>gi|384519690|ref|YP_005706993.1| hypothetical protein EF62_pA0003 [Enterococcus faecalis 62]
MVRIAPCRRSGQALTTPTRNSSCDILVLATAPKGGVNMIESLISLIIAPLFVGLVLLLVDRWLDD
>gi|384519691|ref|YP_005706994.1| initiator Replication family protein [Enterococcus faecalis 62]
MSDKSELAVKYQNELNLVPLKNFNAKQMDLFFALCARMKDKGVENIRFSFEELKELSDYKMTATKAFVAD
LEKLYKDMLNLSYRTENDDEIEYFVLFNGFKIDKKQKFVEVRVNQDLDYIINGLTTEFSRFELSAFTSIR
STYAKTLFRLLMQYRSTGYYVVSIEDFRELLDIPEYYQMGNIDQKVLKPAMKELHNYFENLEVTKIKAKK
GNKIAKLEFTFTGLKTNKPSVTMHDWVNGE
>gi|384519692|ref|YP_005706995.1| hypothetical protein EF62_pA0005 [Enterococcus faecalis 62]
MGLMTGYNMTKEEYEVTQAVLERLDKFESELEALLLDLEPLDLSRLDTVVRDETLRMFNYLSRSYILLID
TVAYKVTLEEDISCGIVKIDGQSLDEEE
>gi|384519693|ref|YP_005706996.1| hypothetical protein EF62_pA0006 [Enterococcus faecalis 62]
MLRYFERLLPKILVGVVQIFGVPPIPLLLFFAFTVEIRLISSCVSEEHKGNWGAHKVPRLAVQGFPVGYT
FVLR
>gi|384519694|ref|YP_005706997.1| hypothetical protein EF62_pA0007 [Enterococcus faecalis 62]
MRSAEGCRLVLERSAFRLPNLALSRLPTVKLSISAKAETPNFPPSENRLNNDCLKLVNVLAFC
>gi|384519695|ref|YP_005706998.1| MobE mobilization protein [Enterococcus faecalis 62]
MRYTLLGSTAEIQRHRTTQEKKGGGALMSKIVARMEKMKDGNLSGIQRHNQRETNNHSNPDIDIEKSHLN
YDLVNPGSINYREKIKQIIESQRISKRAVRKDAVLVNEWIITSDTAFFQENTDTQAFFTDVVAYFSDRCG
RQNVAYATVHLDETTPHMHLGIVPMYEGRLSSKQVFSRQNLLEIQEELPTYLQERGYAIERGLRGSPQKH
LSVKEYKDVQKELQVSKQELANQEQILAEKERELHSYEQAIFRIDRLLEEKNEEVKGKVQAMNQLETKRN
EIINSLQTTVLPDLANVKEKKFSLNGLKYVLSASDFSAIKSITKDFETLRTQNKHLKIENNNLAQKNKEL
TQVNHEQELQITELAYELTLKKEQLTAFEEKQLNYDQSEQIKQELDTTTQTVSVLETENKRLKDKITDLT
YDFSELNEKYQEIKLKFDGLTTYLHERLGHAKETILFTIQQGVKYLQNAPKLKKSLERYSKDRTYLIDEK
GTLFLPPDTGSKGVTMSLNPHFYPLKAPFYNRETGCYEFVGEYMANGRSRTNTLQLSEEQVLEKKAFTFE
QSTDKKAWQQSKKYSRDMSKGRGLSR
This diff is collapsed.
>gi|268687600|ref|YP_003306812.1| hypothetical protein Smon_1504 [Streptobacillus moniliformis DSM 12112]
MSIAKQVKIFSNFKKKSTKVSGSRQQIIDIAGEYERIGEQKNPDINLKLSGENIILKKFDLEEYDNYILN
TDYSLNKDTSKFEDFYSTTPTIQATNFVNLGGINLTFLASKDEWTEFYKDVSQFIKNYMGEDYRILSEVI
QFDEFTPHLQIMGIYRTEIKSSDEKDIRNDKELFEKVASNKFTRYNSSLKGQENYTDPKSKKLYKHAKEK
WIEENREEIIKSYKPRNKKTDMKYCFTTTKTIAAKSNSYQDYQNKLFNFCKEHKFIKELCKKATEIRGEE
VEFVKNSTEKVYDGKSKDHYEIKETIERENKNIEKKILKREPLTEIEMYRYIRKRNREKLKEEFMELDKE
EWRELFNKKIETKFDFNAKIQHDYIALAKEIEYKEYLKLEEEKLKAQKEKEESIIENKKIIEDLKSQKNE
LQQVKDEKENIRGQITKFTNTDKWVNIQMLEKIYNEKSEHKKGMFDSTPMITTTKENYEYIFRMAKDNSS
KLSSFKNSLAEKEFLIANLKEKYQRLEEIKNSELNSKNEKIKQLESTIRLRDNEITNLKQEKKKIEKELD
EVKGELTWYKRTLNVIQNVMKYVPNLKKIVDKIIDKVSNLSNYYDENNATKEINVELGFEEPESAWNKIK
TQGKTLER
>gi|268687601|ref|YP_003306813.1| hypothetical protein Smon_1505 [Streptobacillus moniliformis DSM 12112]
MKRYLKLFFLYLYINIKELKSYGIDFYLGSIAMFLKNISNLFLIFFIYNIVNVINGWNINEMIYLYSIVT
ISFSIWRCFFINTLNISYYIINGKLDILLIKPLNPLFLIFMEGFDEDAWGDLAVGIIIYFYISFKLNLPI
LNIILVFIIALLGGLVFSGISVIGSLFSIIFLGSSNFSDLPYIIYEFSKYPINIFNPVISILFKTIIPVA
WIGYIPAYINLKDGNQNLIIVFLISVFITILYFIIVVLIWNNVLKKYSSSGT
>gi|268687602|ref|YP_003306814.1| ABC transporter permease [Streptobacillus moniliformis DSM 12112]
MDKYIELIKIGGKKILSYKGLITTLIIKNYIYIFLQYSLWLSIKENSSINIDIKNILVYFIIIRSVNSVN
FNLSQYMSYDVKNGNIVGILTKPITVEKYYFFDILGNTIAKVLAILIPNILIALFLIGKFNIFFIFKLII
IIIGSYVLNFVIELILGTFSFFTQSIWGIESLKSIFMLILSGSFFPIEYYPEWSKKMLDYNPFVYIYGKI
ADFILYEKNFLKILFFQTFFVLILFCVYKSIFKLCLKKISINGG
>gi|268687603|ref|YP_003306815.1| ABC transporter ATP-binding protein [Streptobacillus moniliformis DSM 12112]
MEKIISINNLNKVYKIKKGFFSRSEIKTIQALKNINLEIYKGQTVGLIGLNGAGKSTLIKIILGILVPTE
GEIKVFDKEPFENRIENLYNIGVIFGQKTQLRWDLSPLDSYKLNKALYDIPGEKFETLLNKYSEILELNS
FIDRPVRTLSLGQKMRADLLSALLHSPELLILDEATIGVDILSKNKILKLIEELKKDTTIIYTSHNLNEV
YEISDRIIILNKGEIVLDKNKDDILNDIEYLSIKIYLKSPLKYDSLKFREVKISKTNEYEYNFEFIRKDE
LKNFLDYIYLNNLIDYFEIKENNLEKILKEVSNG
>gi|268687604|ref|YP_003306816.1| hypothetical protein Smon_1508 [Streptobacillus moniliformis DSM 12112]
MINKFKNLIKYIEYHIIYFDKKKYIYLDETNMKLVFLSKKNNLKFSLTNAEFFYKQGQNYLYIISLNSNI
LLIKKINFHFKIQIKLYNLNRYYKERLEISNIFINENNELILFLEPINKYLIIGSKLRFKNKLFKKLISN
KEYDFKYIDLVKRIYILKNENNNYESNLLDKLYYYIGIYNQIFIIVEKFIDYFIIKIIKLKKNIKSNKIL
GVISDILSFNNNIFIKYVFSGMTFCIHIDLLNLSEKLIINELKGKVNLYNFIDNKLIYKIDSLLFGEIII
NKSSNYRNNIILRKYIYKDRIKIKEYYSENLKYISIFKDLNKEEEITLISCHGGPESFELLSNNYGGLYY
KLLKEFPIKIIIFNYPGSISFGSEYRKLPYNDWKNVLNKSLNKLLEEDKTKKILIGGSFGGTVSLLIENS
QIKNKILINPLLDLNNHIESIPTSYNKWFYKRFSNKDFRDINLNNILNLNLNKNLYFILGYNDEIINKRN
ILENSFQSKNFRFFWDEGTHNSNLKARSSRMFEIIKKIYKEGK
>gi|268687605|ref|YP_003306817.1| hypothetical protein Smon_1509 [Streptobacillus moniliformis DSM 12112]
MVELIVKDKILISFLGLKTIIYKLKMLEIEKNLEFKRACKILNLKFNDENLKFSLTSSAKIQNQIRFYTK
NKIKREIIKIIKYIIRNYKNLSISINNYDKLDEGTKLFFNIFEELFPNNIKIIIENTDKDENIIYTDQEK
EINYYLKNNFADKNVIEFLIKQTEYYLNIGDYYTALSILNFIEKKETSVKLYTLFSIAYNMKEDTIKSEY
YLKKWYSYGSYEDKASCLYSLSILQARHMETYRRDYNLGLKYINEGYEILNNLRKPDNTRIEINKIFNRN
GYAFFLFNDKKYDEAIELVKKLIEELEKFDINKTLLQKTVLLFNLGQCYTKANYLKEAIETYKKLILLDP
YFAEYHIELSKLFLKNEQIEEALNELEIALDLDSTIPEIYSLKGFISLKNEDLKEAIFNYKEAYILDKNI
EIIYDYIYILSENNEYKEALNIINNLNNYQKTDNIDIISLISEVYYNNDLREKAIELLNEGIRKFENNKI
LLENLEIIKYDK
>gi|268687606|ref|YP_003306818.1| hypothetical protein Smon_1510 [Streptobacillus moniliformis DSM 12112]
MKFTYKEYMALKGIKSRNTLKKYVREGSVKEVKGEDGKLYIIDTQIDTSLIPFETQSIKSAPKIDSQNDI
IKLLNFETENQNKKIKELEQEIKILNIQLENKNNFISRMEEEIKEDKLNYQRLFEQISETNKTYQLLLEN
KKNKKWYQIWK
>gi|268687607|ref|YP_003306819.1| hypothetical protein Smon_1511 [Streptobacillus moniliformis DSM 12112]
MSNKNVEYLTIEDKIQNFNEKNLFLEYNDIFDLDRIDLYGFYEFVFMRNNEYPFELKGKENYVEGQYNSI
IVNIKKEKSFSKIITRDLEELPEFEGQDFVITSPITYIGRNRNSNNARYCYGIAFDIDGVFLSNLQDLLH
QMRTKRLPIANLIVNSGNGVHLYYLFEKPIALFDNIKVLLKDFKYKLTVEIWNMYTSSISEKQVQGIFQG
FRLPGTKTKFGEIVTAFKFNDIPYATIEYLNNFIYEEKKRLTMDQIAMINKSTYRHSKISLEKAKELYPD
WYERRIVKGEKRGKWNIKRDLYDWWLNKIKGNEVKEGHRYFCLMSLAMYAIKCNIDYEELKKDSYSLLAP
MENLTMNEDNHFTKEDIEDSLKAFRENYSTFPRKDIEKITGIIIPPNKRNGRKQKEHLLRARILQNLDFP
NGEWRNKNGKPIGEGTKENIVIEYKKNNPNATMYRCQKETGLSKNTVKKYWNLIEIEV
This diff is collapsed.
>gi|55978436|ref|YP_145491.1| putative RepA protein [Thermus thermophilus HB8]
MVLRAYAALRGLSPEALRAHLLAPPLRPERAREAFQRPYLAHFAQTLPRYPYATDDPKEGVRIYKRENAL
KRVHVQVGHYPHAVLRLVVDVDLPWPQVEERIHALPPSLVLVNPRSGHFHAWYELDPIPLTPPPGREGSL
KGALALLAEVEALLEAYYGADPGYNGLLSRNPFLHPPEWTWGGGKRWSLRDLHRELRGLLPSGTRRRVDP
GLASYGRNNALFDRLRAEAYAHVALFRGVPGGEEAFRAWVEQRAHALNQSLFRDHPKGPLDPREVHHTAK
SVAKWTYRNYRGARVYPVSSTGRPDRSRLSPQARALIPPLQGQELQEAVREGGRRRGSRRRQEAEEKLTE
ALKRLQARGERVTARALAREAGVKPHTASKWLKRMRE
>gi|55978437|ref|YP_145492.1| hypothetical protein TTHC002 [Thermus thermophilus HB8]
MVNPAERLAELDGVLMQYLLEADLLRELPPTYRLVLLPLDEPEVAAQALAWAMEAPNPEGWPSVYALFLQ
GRPIRLLLLGKEVEVAPRAA
>gi|55978438|ref|YP_145493.1| hypothetical protein TTHC003 [Thermus thermophilus HB8]
MYSSAFKESSLSATLAASPGSSGRSTGSWEAMREAHRKNGFLDELAKRWDRLIEKSPPVPSPQGLSPQSL
GGDPKPLDLATEFFRDQVSPQATLPGQCLSWFLWACTAYRNAGYVSFTASTNTLPGDFGNQQNISYPWYW
RGTPKQVYTNPLNAPSRATPTTPGEPGT
>gi|55978439|ref|YP_145494.1| hypothetical protein TTHC004 [Thermus thermophilus HB8]
MGQNHAIGCGPVSVLRILEVYRQRGLEGIPWDITLRLPKDDLSFSGYSVTVPGSARIPSGLPQWAQLALW
PVKLTTQNGKNIYNAWISQALNGKQAGLDQAVLPKDYAPGANRWLADNGLPVRVTGAYLRDFDASFLLNP
YIPITGPIAWVSYTQYTWTTNGLLKDTIGNRDLPAVVLYDSAQIRSGSSYYLHYAPAYRYRVVEYWDWSA
NFATVDNGKEGLSPRPFGPIEIYLSDYYDLSNGVWRISR
>gi|55978440|ref|YP_145495.1| hypothetical protein TTHC005 [Thermus thermophilus HB8]
MRKLVGLGLLASLAVLFSACGEWVFVLTPIDLHVLYYPQNPSLCPGGAGAVSTNNPGFYSLPLKPTTSPP
TPPGPGEIIPFPTPSYGPVTLLPFYTSDRPEKYDLTFYCNAGEGRHLTTPGPRWPPRDYFVDNQKTPVLV
VVEDGGQPGYLRWYWAYR
>gi|55978441|ref|YP_145496.1| hypothetical protein TTHC006 [Thermus thermophilus HB8]
MTSTFNPLPSYMSLGIKRGPGVVNRPFRGSPVQGPNGKLQGREVHHPLLPVREAKPELEALQGPGLHHLR
RRESGAGHPVRTTASELKAFIHRYAQYQRRYPGWPPSSTTTRTGVF
>gi|55978442|ref|YP_145497.1| hypothetical protein TTHC007 [Thermus thermophilus HB8]
MTRDPADYPLLRGQTALLAQALRLVSRDGYRYWQVQTAPTDRILAAVRTLDELHAVLLDRAARAVRRRAR
LPVAQLLLAPVSVMPPENPPPTWPMLIVATAPLPGERMRRVDPSANPRAPLYWVAWRDGWTPAYVLRTDQ
RGRWTWFLEDGFYRALLEAALAYAAEGDWRRLVLHMRTLAHLPMFSGVWSQIQEIRKRVQQYWGDRHLRD
PSGQWKAPPWRAGLEGWPRTPLSPVGMRLYPEEPPRTLGEWWEMHRRGA
>gi|55978443|ref|YP_145498.1| hypothetical protein TTHC008 [Thermus thermophilus HB8]
MNERDLIRHLAHVAHRYAEIVVEGAERHPHLGPLLEALSAATGEEDPRSLPPEAWEEALWGLLVEAIADR
LVDGWDRYGAPSAARDPEGEGYVASAEGPGEPIVVRASTKREAYREARKAWVRRLLE
>gi|55978444|ref|YP_145499.1| hypothetical protein TTHC009 [Thermus thermophilus HB8]
MPWEHYLLPLLDYRIRVEWNVERGRLLSWAVQLEWLDPEEGRFVWVARYDTAGGLPHRDRNRIARHEPMP
HLSPTSGGDLNRARDDLLARAWEYIEAYKAAKAEGREAW
>gi|55978445|ref|YP_145500.1| hypothetical protein TTHC010 [Thermus thermophilus HB8]
MVRNPMELRIGRLHGLFVEHLLRDPGLREALPHPFVLVALDPSDPELMAYALEAAKRSAGEGPMVYALFQ
GEELRLIIAPEGPILPARAA
>gi|55978446|ref|YP_145501.1| hypothetical protein TTHC011 [Thermus thermophilus HB8]
MEPEADALYIAFGEAPPPWRRWPRGVALNWDREGRLLGIEILDASHRLSDPKSLSRLLLEALPVWEKAGA
>gi|55978447|ref|YP_145502.1| anti-toxin-like protein [Thermus thermophilus HB8]
MVVVRLPKEIEERLTALARKTGRSKSYYVRQALLEYLDDLEDYYLAVERLEERLPGIPLDEVERRLGLSD
>gi|55978448|ref|YP_145503.1| toxin-like protein [Thermus thermophilus HB8]
MGYRIEFDPRAEKELEKLDREVARRILRFLRERVATLEDPRSLGEPLRGPELGRFWKYRVGDYRLICHIQ
DREATVLVLRVGHRRDVYR
>gi|55978449|ref|YP_145504.1| hypothetical protein TTHC014 [Thermus thermophilus HB8]
MEHPEGEDPTLLPPALAARALGVSPATLRRYAALWERLVGPLPRDPRGGRLWPKEALARLRAAREAHLRE
GLPLEEALARVQGDFPALALPSEGEALALLRALAERLERVEGELRALREENARLREALKALEPPRRRPWW
RFWGH
Markdown is supported
0% or
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment