Commit b0131d06 authored by Raquel Bromberg's avatar Raquel Bromberg

readme.txt updated. Examples directory modified. Output statements from...

readme.txt updated. Examples directory modified. Output statements from programs reduced. All programs and files not involved in the core SlopeTree routines removed. Some minor code cleanup.
parent a107015b
......@@ -9,4 +9,18 @@ mtax
rapidnj
sttag
tmerg
archaea_run_no_filtering.sh
gc.prt
script_cm.sh
script_stmif.sh
buildconcat.cpp
genome_mapped.txt
readme_conflict.txt
script_do_sttagg.sh
script_strun.sh
buildconcat_output_aligned.txt
merge_hgt_pairs_files.cpp
script_do_tmerg.sh
buildconcat_output.txt
rzs.cpp
script_filter.sh
This source diff could not be displayed because it is too large. You can view the blob instead.
>gi|116334903|ref|YP_802398.1| tRNA modification GTPase [Candidatus Carsonella ruddii PV]
MNTIFSRITPLGNGTLCVIRISGKNVKFLIQKIVKKNIKEKIATFSKLFLDKECVDYAMIIFFKKPNTFT
GEDIIEFHIHNNETIVKKIINYLLLNKARFAKAGEFLERRYLNGKISLIECELINNKILYDNENMFQLTK
NSEKKIFLCIIKNLKFKINSLIICIEIANFNFSFFFFNDFLFIKYTFKKLLKLLKILIDKITVINYLKKN
FTIMILGRRNVGKSTLFNKICAQYDSIVTNIPGTTKNIISKKIKILSKKIKMMDTAGLKIRTKNLIEKIG
IIKNINKIYQGNLILYMIDKFNIKNIFFNIPIDFIDKIKLNELIILVNKSDILGKEEGVFKIKNILIILI
SSKNGTFIKNLKCFINKIVDNKDFSKNNYSDVKILFNKFSFFYKEFSCNYDLVLSKLIDFQKNIFKLTGN
FTNKKIINSCFRNFCIGK
>gi|116334904|ref|YP_802399.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Candidatus Carsonella ruddii PV]
MNIFNIIIIGAGHSGIEAAISASKICNKIKIITSNLENLGIMSCNPSIGGIGKSHLVKELELFGGIMPEA
SDYSRIHSKLLNYKKGESVHSLRYQIDRILYKNYILKILFLKKNILIEQNEINKIIRFKKKILIFNKLKF
FNIAKIIIVCAGTFINSKIYIGKNIKALNKAEKKSISYSFKKINLFISKLKTGTPPRLDLNYLNYKKLSV
QYSDYTISYGKNFNFNNNVKCFITNTDNKINNFIKKNIKNSSLFNLKFKSIGPRYCPSIEDKIFKFPNNK
NHQIFLEPESYFSKEIYVNGLSNSLSYNIQKKLIKKILGIKKSYIIRYAYNIQYDYFDPRCLKISLNIKF
ANNIFLAGQINGTTGYEEASSQGFVAGINSARKILKLPLWKPKKWNSYIGVLLYDLTNFGIQEPYRIFTS
KSDNRLFLRFDNAIFRLINISYYLGCLPIVKFKYYNSLIYKFYKNLINIRKIKLFDNFYLFKLIIIMSKY
YGYIKKKYFK
>gi|116334905|ref|YP_802400.1| F0F1-type ATP synthase A subunit [Candidatus Carsonella ruddii PV]
MVILKKNILNNFLNFKIIDLNLIILLLFIHLIVFYLLKNNNLMILLSIYLNNFIKNSINLNSRNIIFFFS
LVLFNIILFSNFIDLFPNNLIKNFLNLKQIEIVPTSNINITFCFSIISFLIIIMLTHKKIGFKKYIYSFF
IYPINTEYLYLFNFIIESISYIMKPISLSLRLFGNIFSSEIIFNIINNMNVFINSFLNLIWGIFHFIILP
LQSFIFITLVIIYVSQTLNH
>gi|116334906|ref|YP_802401.1| F0F1-type ATP synthase C subunit [Candidatus Carsonella ruddii PV]
MNNLLILSSSIMIGLSSIGTGIGFGILGGKLLDSISRQPELDNLLLTRTFLMTGLLDAIPMISVGIGLYL
IFVLSNK
>gi|116334907|ref|YP_802402.1| putative F0F1-type ATP synthase B subunit [Candidatus Carsonella ruddii PV]
MNFNYTIINEFVSFLIFFYVSFKIIFPVILKKINNFLIIDYKNFVFNNQEKIIKKKLLDEIVKNENLTNK
KFISLIEKIKKSILLEKQNFINFIKLEKINVLKIFKKKILNNNMLIIKNFLIEIKKLFINSFKNIFNEII
CYNNEFIINYV
>gi|116334908|ref|YP_802403.1| hypothetical protein CRP_006 [Candidatus Carsonella ruddii PV]
MFKFINRFLNLKKRYFYIFLINFFYFFNKCNFIKKKKIYKKIITKKFENYLLKLIIQKYAK
>gi|116334909|ref|YP_802404.1| F0F1-type ATP synthase alpha subunit [Candidatus Carsonella ruddii PV]
MLNEGIINKIYDSVVEVLGLKNAKYGEMILFSKNIKGIVFSLNKKNVNIIILNNYNELTQGEKCYCTNKI
FEVPVGKQLIGRIINSRGETLDLLPEIKINEFSPIEKIAPGVMDRETVNEPLLTGIKSIDSMIPIGKGQR
ELIIGDRQTGKTTICIDTIINQKNKNIICVYVCIGQKISSLINIINKLKKFNCLEYTIIVASTASDSAAE
QYIAPYTGSTISEYFRDKGQDCLIVYDDLTKHAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERSSKV
NKFFVNKKSNILKAGSLTAFPIIETLEGDVTSFIPTNVISITDGQIFLDTNLFNSGIRPSINVGLSVSRV
GGAAQYKIIKKLSGDIRIMLAQYRELEAFSKFSSDLDSETKNQLIIGEKITILMKQNIHDVYDIFELILI
LLIIKHDFFRLIPINQVEYFENKIINYLRKIKFKNQIEIDNKNLENCLNELISFFISNSIL
>gi|116334910|ref|YP_802405.1| F0F1-type ATP synthase gamma subunit [Candidatus Carsonella ruddii PV]
MIIKEINSKIKITTNINKLTNTLSMISLSKMNKYINLINNLDYINIELKKILEYIIINIKSNVFCLIIIT
SNKGLCGNLNNEIIKYSLNYIKNNKNLDLILIGKKGIDFFNKKNFYIKEKIIFKDNELKNLVFNNKILND
LKKYENIFFISSKIIKNNVKIIKTDLYLKKKYNYLIKHNFNYDCFLKNFYNYNLKCLYLNNLFCELKSRM
ITMKSAADNSKKIIKDMKLIKNKIRQFKVTQDMLEIINGSNL
>gi|116334911|ref|YP_802406.1| F0F1 ATP synthase subunit beta [Candidatus Carsonella ruddii PV]
MIGRIVQILGSIVDVEFKKNNIPYIYNALFIKEFNLYLEVQQQIGNNIVRTIALGSTYGLKRYLLVIDTK
KPILTPVGNCTLGRILNVLGNPIDNNGEIISNKKKPIHCSPPKFSDQVFSNNILETGIKVIDLLCPFLRG
GKIGLFGGAGVGKTINMMELIRNIAIEHKGCSVFIGVGERTREGNDFYYEMKESNVLDKVSLIYGQMNEP
SGNRLRVALTGLSIAEEFREMGKDVLLFIDNIYRFTLAGTEISALLGRMPSAVGYQPTLAEEMGKLQERI
SSTKNGSITSVQAIYVPADDLTDPSPSTTFTHLDSTIVLSRQIAELGIYPAIDPLESYSKQLDPYIVGIE
HYEIANSVKFYLQKYKELKDTIAILGMDELSENDQIIVKRARKLQRFFSQPFFVGEIFTGIKGEYVNIKD
TIQCFKNILNGEFDNINEKNFYMIGKI
>gi|116334912|ref|YP_802407.1| hypothetical protein CRP_010 [Candidatus Carsonella ruddii PV]
MNLLILSIKNIIEYKNASILNVKTYLKLFSIMNNHINNICDVNQIKLIFKNKIINIRINNGFLFQKKNNT
KIICNFYEFL
>gi|116334913|ref|YP_802408.1| ornithine carbamoyltransferase [Candidatus Carsonella ruddii PV]
MNFYNKHILNDFSFKKYEILTLFEISKKKIKNFLNNKNICILNDKKSLRTINSLINSFNYLNIKYLQILN
NHNIKKESFKDFSRTIGLNFDYLYYRCLNDKILKIIAKYSSLIIVNLLSNGYHPIQALTDINSFFYNKKD
VLMYIGNITSNVIRSIIILLSKINYLVVLISPIKYWFKFLIKKIFPKKKILISEKLILFKKKYYVYTDVW
ESMNNKNVKITDFLNLQINKKLFDLIKIKKVLHCMPRFNKSYLDFEISNLVFESDYFLVNNSIIKKNKIF
KSYIFISNSFFFKII
>gi|116334914|ref|YP_802409.1| 3-dehydroquinate dehydratase [Candidatus Carsonella ruddii PV]
MFVCNKIINVLIINGPNINFLKKREKIYSKISFKKLKKKILKYSKNIINIKFYNSNCEGKIINFIQKNIN
FNYIIINPGAYSHYSIALLDCIKIFKGKIIELHISNIYNREYYRKNSIISLNSNVVISGMKENGYFHAIN
YILSL
>gi|116334915|ref|YP_802410.1| transketolase [Candidatus Carsonella ruddii PV]
MLYNIINNIRLICIKSISKANSGHPGMPLGICDVFTIFFLNFYKINFNNLKSINKDKLIISNGHGIIINY
VLLYLYNVYKIKDLINFRRFNSNTPGHPEIGNFIDASTGPLGQGIGIGIGIGLKSKKYKNKFNNFFNIFN
NKVWIFCGDGCLMEGVSSESCSFCGCYNINNIILLYDSNNISIDGNVKNYFNENIKLKFISLNWNVIGPI
NGHCYFSIIKSLLKAKKSYFPTIIIYNTIIGFISPCKSYNENSHGNIFTKFEFLEILKNFTLTYDYVKKM
FFDNKKKYLIYYKKKYKKYFFELIRIFNNIIPKINFLKLYFKYYKINLNKSTRFVCSNILKNIYAINETF
GGSADLTNSNLTKNNFINSIRYKNFKNRYINYGVREFTMGLINYGLSSDKIGINYCSTFLVFSNYMYSAI
RNFCLSKLKNIFIFTHDSILVGEDGPSHQPIEQLHSIRIIPRNYIFRPYNYIELILCWILILKFLNNCSS
LILSRQNFKNNFIKIYNIKNIITGTYSCFYKKKIELIIVSNGSDLEICFECYFFLKKYFIIQIISLFCNK
LFDKQKKIYKNKILNCKKIIFVESSNDDFWYKYKKYFTYVLNIKKFGYSSNELELKKKTNLNKKFLIKLC
LFVIKL
>gi|116334916|ref|YP_802411.1| hypothetical protein CRP_014 [Candidatus Carsonella ruddii PV]
MLYNILKFKIFFFKIYSICNYKTNTFSILNKKIKYNFFLNFINYYINYLNYNNKKKIGILMYFKVSKVIS
SFNIEKNGIFFFSNKNVFLYKILKNYDINNIYHVIKIIKINKIKFNLKILKKIFTKILKKKRKEVYEKLE
ERYLITILLNNLNETKNKIINIYKSLINYNTNNFFLINKEFNKVCSLLYLSKNESLSKKIHLGLIKNNFK
EETPFYLNYIFNYFLKFNELKLTISIEIYNLDILKIIKTIKKNKKIKIFINVGINDLFFEKIFKKKKIIL
FNSFKIKKEYGYYVQNFFDEYVGYGSFRKMYFKIFKNKNIFKIKICAKYFFLKILKTKNLKIYFLDSLNR
NNLNKHISNLLTGFFHPKIFDKNNFFKKKYFFYKNNNILINKNNSFYLEIKFFVNFKICKYIKKKIVFLY
KFFNKESENYIIKKEINFCLNYRIKPITIYFHVVNKKVEEYINFLILQINCNLSKKNNSYCWYFGSNIYN
SNFFYIKKYISKKWNFIIKKIILFKIKNSVYLNFKIKKTNLKLISLDNFLLKLIIKNWQKKNEKY
>gi|116334917|ref|YP_802412.1| 5,10-methylenetetrahydrofolate reductase [Candidatus Carsonella ruddii PV]
MKNISFEIFPCNNIKDLSVLINYLNKNKPSFVSVTFGKINNLKFVKNIQKQISTKIIPHLICDNIFNIIN
YIIYFIKIKIFNFLIITGDKNKNNSIKYIYFIRFLFGHIIKIITGCYFENHKFSKNFKNEILFHYKKNKI
GTNMCITQFFYNFNTIKYYINIIKKTGISKNFILGIISKKNIKDILNYTNLCKIDIPIWIIKNYKEFNIE
LFFVKNLKKYKNLHFYTFNNINLIKNYFK
>gi|116334918|ref|YP_802413.1| hypothetical protein CRP_016 [Candidatus Carsonella ruddii PV]
MIKVNVLNFVRNFLIKKIFFFINKKFFFIINYFVYLFYNNKIYLK
>gi|116334919|ref|YP_802414.1| succinyl-diaminopimelate desuccinylase [Candidatus Carsonella ruddii PV]
MILFFNSLKKILFKSLSYCCKKIFLIIIKYFKLINIELIKIRKVINLHLFNISYSYLYISHIDTVHESNV
KWLKNPFSSYLFKKKIINRGIIDMKGSFISVLFFNKNILNFILTNDEESVSIYGIQYSISLLSARKKKFF
FFFGTEPTSENIIGDYLKISRRGSFNLKIIFLGKIKHCAYLGKNLIKMLFSFFFLKKDIKKNILEYTNIF
CGNNTDNLLSNKLFLKLNLRFNSFYSIFVLKKKFLFFLKSKNVYINWNLSGIPFLCYKNFYLIKILNIIN
TIQNIKTKINFLGGTSDLRYCFYTYYNSEIFEFGLINKSIHKINENCFLDDCFILSIIFYFFLNGIK
>gi|116334920|ref|YP_802415.1| tetrahydrodipicolinate N-succinyltransferase [Candidatus Carsonella ruddii PV]
MLIFSLCNYSTNFKNNFLEAKFYFIKKKVELKLLKIKFVKNKILLNIKQAIFLNIFNNTWKKIKFINLQI
KITKINNKIVDNIDGLLKLNIISLKILKPNCLNLNNLFINLKNIVWTNIGFYELNDFFILINKKNISLNQ
LIIESIDKIPFLSKYLVINNVRISNTNRVRLGAYLCSGTTIMSEGYVNFNTFIGKNCMIEGRVSSGVSVF
NNTDIGGSSSIMGTLSGGGNNIISIGDKCLLGANSGIGISLGNNCIVEAGLYITSGTKIFFLFNNKKILI
KANKLSFKNNIIFFRNSVNGKVECLKTNFVVKKTNIILHKN
>gi|116334921|ref|YP_802416.1| methionine aminopeptidase [Candidatus Carsonella ruddii PV]
MNNLHIKNFIKCGNKNNILIIIISNYYFCYSLAELDYIVFYYIKILNLKSSTINFKNYKFCSCLSISNIV
CHGIPVFEKINFLNIKIDIAINYQNKHSDSCINLFKNKKFNFLKKIFLNLIKNIKRNNFFSKIGYLINKI
KNSKIYITEEYCSHGIFDKLHNKNIIFHNVNNNKKKIKNFDSFTIEPMFNYGNCSGFFFLNIFVSKKNFY
TFQWEHTLFILNKKKIITTIRKIELC
>gi|116334922|ref|YP_802417.1| ribosomal protein S2 [Candidatus Carsonella ruddii PV]
MKIIHLINSDIFIGNNKKFLNFSMKKYIIFTINNLNIFDLKKIIISVLLLKKYIKFIYKKKMKILFIGTK
NFFRELIYKFSRSIRQPFVCNKWISGSLTNLQNYKKMINKLKIIRKKIKFKSYTKKEKISFLKKEKKIEI
LFGGFRNLKKTPKLIIISDINKDKIIVNEAKRLKIKIASFLDSSDNCSKIDFILPCNNNSINSIKIILNI
LFKNLC
>gi|116334923|ref|YP_802418.1| hypothetical protein CRP_021 [Candidatus Carsonella ruddii PV]
MLNLIVQLRKQTGISINLCKIFLQKNNWDILSCIKYIGKMKIRNKNNYNYYSIINFINNNKIYVLKIKYN
SIIINNSNIIINLINDLKKKIIKKKIIFKILNILSVKLNENVFLSFYFCLVNKNLEFYNHKNLLFCLIKF
NSLNFLKKKDLCFQIISKKTKFIKFKNCIFSISNQKSVVTNDKFDNLLINKIEYFFFINKKKIKFIYE
>gi|116334924|ref|YP_802419.1| hypothetical protein CRP_022 [Candidatus Carsonella ruddii PV]
MSNYQIKIKNYLNLFKEKAFFINIKNLNIEIFNNLKIKYNNSYINLRELCSIKNIDKKKFLFIFNDQKIL
LYLIKSKYFENFGFNILKKKTTIELLVPNISREFRINFLKIIKQEYEYFIEILESLRKKELLHIKIQNIS
KDEILRQEKVIKNDFINYKKLFKNELENISNKIFND
>gi|116334925|ref|YP_802420.1| DNA polymerase III alpha subunit [Candidatus Carsonella ruddii PV]
MIKFTHLNVHTEYSIIDGIIKIGKLLQIYNKLGIKSISITDILTIASFPEYYEYSLKKKIKPIIGTECFL
LINGKILNLILIAKNYLGYLKLIKIISNAWRYGNIENGVFLKLHWLYKFKNKLIVIINLRYYLLESFFNF
CEFSIFIKELTINYNNNFYFEINRINLSLEELINNKIIYFSKLFNIKLVATNSVKFIFKKDFPINLSKIL
ICQNKIFEEKLFFDYSNQQYIKTYKDMKKLFFDILESIENINLIILNCNVLFNFYKFNLPKIKISNFKIR
KKIFDNLVKAGLKKRIKKKNKQIKIYLNRVNKEVLLTKKLGLIDYYLIITEFIFWTRKKNIISGPGRGSG
SSSLLCYSLYITDIDPINENLLFERFFSSERLGIPDLDLDFCVLERDNIISHLYNYYGYNNISQIVTFHT
VSAKSSIRDLSRAIGMDYISGERFSRSVPFSIELSMEHIFRENISVRSYISKNHKCFEIWKISSKLEGIA
RNISKHAGGVVICNTGLNNFTPILFDENECMTHYEKIILQDIGLIKFDFLGLKTLSTISLTLKMISEKNT
GEFFIDDYHTFQMINNLDTELIFQLESYGIKKIIKKLPIENIFDLINLLSLYRPGPIQSGFINDFINRKN
NIVKTYHPYSDCDFLQSKIILANTHGMILFQEQVLQLILFYTKCSNYDSEKIYASMIKKSKIKLKISKLI
FINECNKLGIDKKTSSKFFNIIEKFASYSFNKTHAHSYSKIVYQTAYLKSNYLLEYCLSNIYVDQLLGID
INNIINIIKSISVFFYKPDINLSDENFKIYKKGILYGFDIVTFIDENFIDKVIYYRNKLFYYNNFEMFCK
IFSVFKIKKKKIIENLIFSGFFDCFKINRVILFVNFQFIFENILTLNNEYSRTITYKFVRYFNYAKKFFL
FKKILTISSINILNIEKKILKFYTSFYPLVFYSLKLIGHKNFNLFKRIELNNFNILIAYGKSKKNEKKKA
YFIGYKETILKFYKFSFRTILPWNNINVIFFLKYDFKKNKHFIIHCFRIKPFLKTIGSILVIEINCNIFF
LYNFVKKIFNFYSFYGEKIYFLIKIKKKKKILDLKININLNDIFFQYLKTINIKRIFYLNSCK
>gi|116334926|ref|YP_802421.1| hypothetical protein CRP_024 [Candidatus Carsonella ruddii PV]
MKNLFLIKNLCNLFSFGKDSVFFFFKCFYKKKKNIFINYNLIYFKKYFLQFFNPEINIFKKFTFNELIFR
KIKISIVKNTFVYMHIMNHHLLDKIETIFNKLIKKKKQIVIINNWYFKNKYVMKPLINIFLKNYKLNIKD
SSNKYIFIERNFLRCLISKFIK
>gi|116334927|ref|YP_802422.1| 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase [Candidatus Carsonella ruddii PV]
MKIHLLGSPNIGKYRELKFITEKYWKIQNNINLLILKMEIKKIKMEKIYYQVNNNFNYIGFGDFTLYDNI
LDISCLINTINNNLDIVNIKKYFSIARGIDKLNISKMTKFFNTNYHYIVPKNFNNLKIVNNTLFKDIKNI
IQLGLIPKLILFGPVSFLYLSNIKIDKLKQLLEIYLYILKKNLKLINLTIQIDEPILSLKLNNYWKKIFL
FFYKNIQKLNFNLILTTYFEYINNLEILNDIKKCILHISPKYINLINNHNKSFGIINSNILKTNILEILK
IKYKKNIFFSLVDNNKLLPYDISVEKNNLIKKFFSFFYQKITELKLIKNIYLKKINFLDILYLKNYSIFN
EKIIVKKINKKNIKCKNTINKKLLNYTTIGSFPQNKEIRILRKFFKKNVLLKNEYKLIIKEYIYILVVKQ
ISLELNLLVNGEFERTDMVEYFANSINGMYITNNGWIQSYGTRYVKPPIIVDIRNSFNITEDWLYFFKYI
VSLPKKVILSGPITIIKWSYCINEKYKFIFCYKLSELLNSELIKLQLYGFKIFQIDEPTIKECLPINIKK
WKLEINNFLYCFNNSTKNINKRNEIHTHICYSIFDNIINIIKKMNINVITIESTRENMNNLNNFKNINLN
IGGGLYDVHSSIIPYKNDIKKRIIKHTKIINLNKIWFNPDCGLKTRNWYEIIFTLNIIKNVKKKILNYYS
>gi|116334928|ref|YP_802423.1| ribosomal protein L31 [Candidatus Carsonella ruddii PV]
MKKIYFLCICGKKYSILSNCNKNININICSGCHPFFTKKKNNFNNSEKTIKFNKKYELFFKK
>gi|116334929|ref|YP_802424.1| hypothetical protein CRP_027 [Candidatus Carsonella ruddii PV]
MNYFLKNNFILFGDSCSGKTFIYKKIEFSKIDIDFFLSYKNIFFINEFFFRYFEKKILKNFIKNKIIVLG
GGCIQYLKKKKIKKSILIFKNINFIKFIKIKNIENNRPLLKKKKYIKIRFVIRKKKYSKIANLILNKCII
CNLRKIYENNKI
>gi|116334930|ref|YP_802425.1| 3-dehydroquinate synthase [Candidatus Carsonella ruddii PV]
MKIIKFKKKSLCSLYITNDYKKFIKISNKLKIIITDYNVYINFYNLIKEIKNYKFIIFPCGENFKNINTL
KIIWKFLIKFFNKNISLLSIGGGVINDIVGFICSVYLRGINFIEIPTTLLCQIDSSIGGKNAINFFSKNT
IGTIKNPIFIYLNYSIIFYMNKNDLKDGFAEIIKYFLLNNLKFLFYLYKIFNFKKILIRSCYIKIKIISQ
DYSEKSIRSVLNLGHTYAHCIENNKINKISHGKSVLIGIIFSLFVSTLYYKIDLFKIFKILNLFLIFKFK
IINKIKFSDEMIKKIILDKKFNKKINFILFKKISCCTKKIIKKKNLLLLIIFFYEIKINNKMANKSSK
>gi|116334931|ref|YP_802426.1| dihydroxy-acid dehydratase [Candidatus Carsonella ruddii PV]
MKSKLITKWPIKAANRAMLRAVGYNDYDFNKFQVGIASTWSNITPCNNHINVLAKAVEYGVNSKFCKGTI
FNTITVSDGISNGNFGMKYSLLSRDIISNSIEVVGKAQNFDGIISIGGCDKNIPGCIIGMCNLEIPSIFI
YGGTILPGKNRTDIVSVFESLGKFYNKTINEKELLNIEKNSIIGSGSCSGMYTANSMAIVAECLGISLPN
SSIQNAQSINKIVNCINSGKLIKILLENNITIKKIINKESILNSIKVISLLGGSTNCLIHLLAIANCLKI
NLSLKDLQFETNNLPTLSDLKPSGKFFISDLINTGGIQKFLKYLIDINLINGNLLTVTGNSLKENLKFIK
INYKNKILKDINNPVKKTNQIKILFGNLSINGCISKISGKEGEIFFGKALVFNSEEESVNYIYKKKIQNN
TIIIIRYEGPKGGPGMREMLTPTSALIGVGKKNSVALITDGRFSGGSHGFVVGHISPEAYDFGTICLINN
NDLIIIDTINNFISLFLNKRSLKSRFYKVKIFNKIVSGILNLYKKYSICSSKGALLNYE
>gi|116334932|ref|YP_802427.1| hypothetical protein CRP_030 [Candidatus Carsonella ruddii PV]
MNKNIFIILPLIFNIYFYNNVINSNLVLKFSNKHTKNFINFKIMFCHYIGNMTGSYFFSKRVNVNLVPIS
LYLFLFFLNTVFFLVKCSYNLYFCLFCKIFIGFLISSINNTSDFYVSKYNKKISNFYNSIIYFSSFIAQN
ILNLYKINFLNSDNLYIFLFLITHLNNKLLLIIDDIDIKNKKKIKFKNLEKPNFYIMIVFMFIISFISIL
NNYINNMFKKSITNELSTFTNFTSLGGALSFYIITFFNDKDKKKLLILFLSLLLTLSSLITYFLNYKIIK
CYILFLIGLFTYPIYFVSCSVLKKRFSKKNNIFYSIANSISYAISPFFSIVYNKNNIFIFFTYIKIITIL
YLILLILCIKKYEF
>gi|116334933|ref|YP_802428.1| serine hydroxymethyltransferase [Candidatus Carsonella ruddii PV]
MNFKNILNFIKIESKKQEKTLNLIASENYSSITSILYSSSCLTNKYTEGYPNQRYYSGCKFFDIIENKTI
IETQNLFNSNFANVQSHSGSQANFSGIQSLINKNEKILSLDLKSGGHLTHGFSKNFSGKYFDIVNYLLDK
NFSINKEYLYKIIKKEKPKILILGYSSYQKYIDWDFFYYLSIKNNCFVISDISHISGLIASGLYPSPLNY
SSLVTTTTHKTLRGIKGGIILTQNSKIIKKINLSVFPGQQGGCISNNVLGKLITFKEANNINFLNYTKQI
IINSKIMLKTFLYRGYKTIDLKTENHMFIIKVNNNSFYLEKKLEKYGILINRNFIPNDKNKSLNPSGIRI
GTSCITTRKIKKKGSELISNYICDLIEFNNNIIKIKIRVLCLIFPIYK
>gi|116334934|ref|YP_802429.1| putative ABC transporter permease component [Candidatus Carsonella ruddii PV]
MNNYNYYSIINSYQIENKYCENLINEISYINTEPNWLKSFRINSFNIIKKINIPKWGNFFLKKIILSKSC
FYNFHDNNNNYSLKKTFKQIINKNIATDFVYNSISIKTTMKKKLLKHGIVFCSINEAIKNYSELLRKYLG
SIVKPQDNFFSCLNSSIFSDGTFVFIPKNTICPIELSSYFRINDEIGQFERTLIICDDNSQLSYLEGCTA
SIKKKQQLHSAVVELIAKKNSTIKYSTIQNWYVGNKFNYNGIYNFVTKRGLCFGNNSLILWIQIESGSSI
TWKYPSCILKGNFSNSEFYSISITNNYQQVDTGTKMIHLGNKNYSIVNAKSIALDYSFQTYRGIIKILNN
ANYSKNYTSCDSILIGMSKIYTFPLNIVNNKFCKIEHEASVSQISFDEINLLKSKGIKKKDCYNILINNF
CYEIFKKLPLEFNNEIENLISSIIKYSVI
>gi|116334935|ref|YP_802430.1| putative ABC transporter ATP-binding component [Candidatus Carsonella ruddii PV]
MIKIKKLFIKCNNFYIFRNLNFFFLKNNIYVLTGNNGTGKSSFLKSFVNDENYFLTGEIYFQKYNIKLYE
LDFVSRIGIFISYQNSIEIKNIKNIFFLKTCFEIFNFNKKFFFKKLKCYIKLLFYKKDLLNRSYNVGFSG
GEKKKNEFLFLLIINPILILLDEIDSGLDQTSVLIIFNYLNLIKKNKYIILISHNKNINNFLLIDFYLKI
KKNKINILKCI
>gi|116334936|ref|YP_802431.1| hypothetical protein CRP_034 [Candidatus Carsonella ruddii PV]
MYIKKILNRKKIFFVIKKFFHLNKYKFLLNFNYLKRLFFKKVKLINLKCCNFKKKKKINNIINYFFLNTL
FLKVNYVNYIITIINFSNLNIYFFIKNCFLKIKIISKNKINFYIFFSKIIFFFKYSFIKIICFLFCSLFI
KFFFFLKINKLFFTSYLINQKNLLFIYYLNYNKHNIVKFKIFFFHFSKFNFSIEKFFSYNNNNIFNVKSN
IYITKKKNFIFQNYENYLKKKVKININLKIFLNKKNVFCKHKIIFYKNISKYYLLEKKFFCNLLL
>gi|116334937|ref|YP_802432.1| selenocysteine lyase [Candidatus Carsonella ruddii PV]
MKKYFPIFYYYKKIIYFDSSSTNQKPKIYFKSILNCVKKKNFNINRGDNYLIKKVNLIIKKFKLLIKKLI
LNNYIEEIIIFFNSTYSINFILNSLINLINEKTNILISNMEHNSLFLPILKIIKFKNCKLIVFPTINNNL
YLNLICNYFKNKIFFFIINQISNLGLMNQIKKISTIVHYNNSIIIVDATQSISFINVNIKYSKIDFFFFS
LHKIFSSTGISILYYNLFYLNKLLLPNYGSGSTLNINYKKIKIKNFNEKFEIGTQNLIAIFSSYYTIKWF
LKNKKYFFYINNFLKNIFFIIFKKKKKNIINNYLIKINKNIFFIYFIELNKIISRCDLLCNFSKQLFLNK
NINCRISINFYNNIKEIIKLKFLIFFFNYNITNN
>gi|116334938|ref|YP_802433.1| putative tRNA(5-methylaminomethyl-2- thiouridylate) methyltransferase [Candidatus Carsonella ruddii PV]
MLNFLLNSGGKDSNYSSILVNNNNIFIKIDNFCENLLDKKYLFLNCIINKKKILIINLKNEYNFFFDFKN
SKFIFYNLDFYCNKFIKINLVKQIIFKLNLLTGHYFRIQKNFFFVSIDQKKDQCYFLNFKKKIHSNIGFF
NKLIITYITKKKNFVCKCKKSTTGICFKINKNFFFCNYYVFENKNIFETNYCKLFYNLGQLYKKNFIVKI
KYNQIIISKYNYLSKTKILILKLNFNYSKICKIKINSQNIFKNAKIIFNKKKCYLICYKFIYFIEKNQNC
LIKYNELIISNIIIKKKN
>gi|116334939|ref|YP_802434.1| translation initiation factor IF-1 [Candidatus Carsonella ruddii PV]
MENNNNNVFFEIEGIVIHANQNSIFKVKVNNGSIITASISGKIRKNYVKIMIGDRVKVIISQYNLFKGRI
IHRF
>gi|116334940|ref|YP_802435.1| putative thioredoxin [Candidatus Carsonella ruddii PV]
MILVNNNNLINKLIKKKSILLFSANWCKPCKILKKKIKKIEQNSSLIFFEINVDLFQEEIVKLNVKNIPT
ILINNKVKKFYSGILSIKKLMFLIKQNF
>gi|116334941|ref|YP_802436.1| 6-phosphogluconate dehydrogenase [Candidatus Carsonella ruddii PV]
MLINHIGIIGFGSMGKNISLNLIKKKIFLSVYNREKIYLNKKFFNIKIITNNLKKFINSFSNYKIIIILI
KPGLPVKNILFLIKDKLNISDILIDFGNSYFKNTYFNFLNIKKKFSFISAGISGGSEGALRGLCLMIDGN
FLTIKRLLFFFNIISLNIYSRCSYSISIGIGSAHYLKMIHNAIEYGILQIISEIYFFLKIILKKKKKIIN
IINIWNKTELNSYLIKILINILIKKSIKILDKIDQKGTGSWSVISSIKNYININSIFEALIIRIISNNIY
IRNLINKSNNFFIKSNISILIFKVKKTFFFCIFFCYLQGFNQIIKIKKKYNWHYNYNNVFKSYLDSCIIN
SSIIYYLLNFKKNFFLINKFLILIKKNINYYKEFFLLIINCEIISFTMFSCFNFINIIINKNYNFKYIQL
QRNYFGNHLLKFL
>gi|116334942|ref|YP_802437.1| hypothetical protein CRP_040 [Candidatus Carsonella ruddii PV]
MKFKFKIKIFNTKNLSNKTVPGILYIDNNIYYIYVLKNNLINKVFKNSFLNVLYYKKNIKVYIKNTKFSF
IKNSIISFELKNVLFLKYKIKTYNNINNYTCKIDFLCKNNFPRKIKLNIFKIKKKFKYKDFNFKFKINKI
IFFKKYITNTLN
>gi|116334943|ref|YP_802438.1| putative peptide chain release factor A [Candidatus Carsonella ruddii PV]
MKNYLIIEIRQGIGGEESINFAKDIYKMYVKFFEKQNINFEIISNSNFKEIILKVENNVFDKKLLNESGI
HRVQRIPKSETQGRVHTSTCTVFVANINLDNNLKLKNEDLKIEICKSSGSGGQHVNKTNSAIKIIHLPTK
IAVECSDERSQNLNKTKALIILNMKILKFQKNNYNTQLNNVRKKLISNSERAKKIRTYNFTNNKITDHIN
NKNYFQLNKILNGEFNLID
>gi|116334944|ref|YP_802439.1| aspartyl/glutamyl-tRNA amidotransferase B subunit [Candidatus Carsonella ruddii PV]
MFQFKNFLVLKIGIEIHVHLKTNKIFTNNKKNSYYDIAIPGILPYFNYLIKYLIVFFCFNLNSCFFNFSV
FERKLYFYYDLPKNYQITQNVFQNIFNLLLNNYCEKKILIKKIHLEEDAASTKNFFLKNINYNRSGNSLI
EIVTEPNFNNLNCLILFIKKINKIIKNYFISDCNMYNGNLRIDVNLSIINKFNLLKSKKTEIKNLNSYEN
ILKSSFYEVKRLLLNLEFKKKTYFSTRNYIQNKTIKIRNSNLKNYNFDIDNDIGIMSYYNYEVIKKFNKK
FRLKNIFNILPKKKYFFLKKIYFNKIYNTKNFSFFFFSKKNKIMNIFYYNFSIIFFLKNKKKKVLYYKFK
KKIIKILKYFELINF
>gi|116334945|ref|YP_802440.1| aspartyl/glutamyl-tRNA amidotransferase A subunit [Candidatus Carsonella ruddii PV]
MNNLFKLGIKKIFFLIKNKKISYFEIIKVCINNLSKLNDKNYFVLETLEKESLKIAKKLDNTNPKILSIP
ISIKNIYSIKNKLLSCNSKILKNYFSTYNSSIIKIIKKYNLIVISLDKLEEFCIGESGKNNCINIKNIYS
NLYLPGGSSSGSAISVSSGCVIGSIGSDTGGSIRTPAIFSNLIGFKPTYGKISRNGMVPYSSSLDCCSII
TNYSSDCKFLYNILSTKNLDLLSFKKYLYVKYNKIKIIALLFDNLYYDYESKKKFEKVILNFKILNYTII
FKKIDLSVLFYEYTILSSKEFYTNSCRYDGIKFGYKKNIFKNINDFTKLNRCFYKTCKNKILLGVQNFYL
KNQKIKINKKILNFFNELFIIADFLIIPSLNNFKIDNINYSEYCDYITVFSNLIGYPSITIPIGMINHKP
FGFNIIGELQSDNLILELAIRYEKFFLNNYVSI
>gi|116334946|ref|YP_802441.1| hypothetical protein CRP_044 [Candidatus Carsonella ruddii PV]
MINIFFFLYVKYLSIKCKLLNFKFNKFLKNYIIKFKNFKKSFFLKLNIIKKKNKKTKTVKIRNIFI
>gi|116334947|ref|YP_802442.1| ribosomal protein L13 [Candidatus Carsonella ruddii PV]
MIIINCLNKKLGRILSSISKIIIYFNFFKKKIKIFLINIKSFVLKKKTTITHSGYIGNLKVKCKEKNKKK
YIKKSIYNMLPKNYNRLILLKNLFFIL
>gi|116334948|ref|YP_802443.1| ribosomal protein S9 [Candidatus Carsonella ruddii PV]
MKYISFSKKKKTITKVLIKIGTGIIKINSLSIKKYFGNIYNKNYLFIPLILVNLKNKNILINTKGGGKNS
QITSIKIAICKCILLFNFNYYKLFRKLNLITIDDRKIERKKYSYKKSRKREQYSKR
>gi|116334949|ref|YP_802444.1| hypothetical protein CRP_047 [Candidatus Carsonella ruddii PV]
MKNKHTTILPNRLLYKKEYLLDFTFGCGGYIKNLILKQKFKIIYTIDVSQISYLISNKIYNKFFFFFRLK
IKNINKIFKRFNLINVDFIIYDQGINSYEIKNFYYKLNKKKYLENKVKLNVLNLKFIFFKIIKYFKKKFK
LLILTFSLYEHYKIILFLKKIKKIKIKIFKPNKFEISLNNSIKNVLIHLIYVN
>gi|116334950|ref|YP_802445.1| hypothetical protein CRP_048 [Candidatus Carsonella ruddii PV]
MLINILKKKILFFYFKIISFKKKKIKTLGPYGNYCYNILLKKINKKYYFYPIISIKKILNIKKYFFPIEN
NNGGLVNDSINLLFNNNFFFNCILIININHKIFLYKNKKKIFLHNQSLKQINYNLMFKFFKLKILKTFSN
TIINSGINICNSLTKTILLISIKNVFLKNNFINKTKFILFNNFINKKVLISFFINKNFFFLFKIIKNITN
IYIKNKIFYIEIFFFSLRILLFIMKLFKNKIKIKFKSFHSIL
>gi|116334951|ref|YP_802446.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatus Carsonella ruddii PV]
MKSYYKINCLNNKNRIIRTGDKSISHRSIICIIVKKQIIEVLNLLESSDILSTINLFRNLKLQIYGPINN
YLLISNFKKKNQKNNINFIGNSGTTIRISLSILFNNNIIIGDKSLNNRTMYRIIKPLSLIGFIIQCKKNF
FTPLIIIKKNNFGLKYNLVNISSQVKSCLLLYSLFSFVKIYLIEKKTTRDHTERFFHLINKKKNVLVRIP
NDFSSLTFLMCYFIKQNKKFILILNFNKFRIGFFDFLVINNINFFFIYKKIINNEHIVKILFLNFKLRIK
TIYSNNISKLIDEIPCLLIFLLNFNAKIKIYGLEELKFKESNRFLNIYKNLLLLGIRIIKKKNYLIFKCK
KFHLNFFKTFNDHRLFMSIFINNSFNKISNAENIISSFPFFLKLFNNKKNKFYVKTK
>gi|116334952|ref|YP_802447.1| putative ribosomal protein S1 [Candidatus Carsonella ruddii PV]
MLKLNSTIKENILSFYDEYIITNFLKTIYLKKINFNFKKIVNKFKKKKIVYNIFFFSNLKKKIKTGYYLD
NECLLYLSNNLIGLKKKILQKKIYLFEILFKIIIFNKSKFITRKINFKKKKKIKIKINKKYIGIIKNVVS
YGIFIDIGSLDGLLHISDIPKYKKVYKNLFTKNKIIVKITKFDRKLKKISLNLKKTYKKYNLIFEEYIIC
KIKKIEKNFFLCLSKYNKIFIKKNSNFYKKNDIIKFYLIKKNENYLFLSKYYKLYKNRNKYIKYNLKLKF
NEFYLFSYKNKKFISNKNNRITKIKKNEFYKYFISKIINNDFYKIIYINKKNYIKYGNFFLLTNINFIFT
INNFKIINNNIFFFLKKY
>gi|116334953|ref|YP_802448.1| chaperonin GroEL [Candidatus Carsonella ruddii PV]
MGYKKIKFGDDARKSLAIGVNILADAVKTTLGPKGRNVILDKSFNSPLVTKDGVSVAKEIELKDKFENMG
AQMVKEVASKTSDVAGDGTTTATVLAQTIVNEGIKAVISGINPMDLKRGIDKTIYQAVLELKKISIPCVD
TLSISQVGTISANGETIIGKIISDAMNRVGKNGVITVDEGRGFEDELEVVEGMQFDRGYISPYFISNQEN
MSSILENCLILITDKKISNVRDIVNILELISKKNKSLFIIAEDIEGEALATLVINNIRGVLKILAVKAPG
FGDRRKEILKDISILTGSTLISEELGIKLENIDLSLLGFAKKITSTKENTIILGGGGDENSIKKRINTIK
KQISESLSDYDKEKLQERMAKLAGGVAVIRVGSATEIEMKEKKARIEDALHSTRAAVEEGVVIGGGVSLI
RILNKLKNLQGDNEDQNYGIQIALKALEAPLRQIVKNSGGEPSIVLNNIKSSSNNFGYDASTGKYGDMFK
MGIIDPVKVTRSALQSAGSIGGLLITTEAMIADYSDEKSV
>gi|116334954|ref|YP_802449.1| chaperonin GroES [Candidatus Carsonella ruddii PV]
MKFLPLYDKIIVKKIELENKIGSIFLPFNDNNLIKGEIIEIGCGKLLQNGEIKKLIVKKKDIILFKDNYN
IEKYKSDNINYYFLKEEDVIAIIENGL
>gi|116334955|ref|YP_802450.1| hypothetical protein CRP_053 [Candidatus Carsonella ruddii PV]
MFLVKNFGNINSCIRTCYMFNVYVIIKNIYINSFVINYNNIIFIKNNILLLKFIKKTNCIVSLSISSYFV
LNNFKLLKKFVIVIGNEKYGINNSIILHSDFILKIKSYRKKSLNLSIVSGITLYHFIYNNEI
>gi|116334956|ref|YP_802451.1| hypothetical protein CRP_054 [Candidatus Carsonella ruddii PV]
MKYNIFIFFKKYKNKFFSIFFKNLVFFFYKFNIKILKIIDFGNIISFKKKNKRLFLIEIECIKNKVITIF
KLFKSKNDVLSFFIILKLSIIKLITNNNYKKYLSKNFLIIPSLLFKIKFIKYKKIVKLIKILRILGILPY
SIRNYISKINILC
>gi|116334957|ref|YP_802452.1| putative replicative DNA helicase [Candidatus Carsonella ruddii PV]
MLENISSISSEYIIINYIFNNFKYSNNIFNIINENDFFYEKTKKYFIEKKFFIKLNSIDETYIFSNLKNL
VEKTKKRKMIKILFNIVFTLLNEKDIPVIIYEKVKMLLNFKETNKIMKLNYFEMLKDYLFNKETPIYTGY
KSLDNILNGLQKGDLIILAGRPSIGKTSFLLNLVKNLLFLNNKIIIFSLEMTVLQIFIRLISIISEVNQN
KFKNNDFSEFDIKKLSCLFKNFNFNNLIIVDCSSLSPNDIEIQLNFYKKNNLIINIICIDYIQLMKSEIS
NNNRVLEISDISRSLKLIAKNFNCVIISLSQLNRLIEHRIEKTPILSDLRDSGSLEQDADIVIFLNNKYK
LVELSILKNRNGPLGNILFSFINEYTKFNQV
>gi|116334958|ref|YP_802453.1| hypothetical protein CRP_056 [Candidatus Carsonella ruddii PV]
MNIQNLIKFKKEFGQNYVLFQKKKKIDFCSGFNFFNCLTNDLDYLKSCFCKNKIYIFNNKNFYKNFLIFF
FPINYIVNINLPFNIINFFIKKQFKIKNFYFKLIIYFFFITKFKITGIVNKIKFFKINIFYPFTKVKIVN
ILYKKNVYLKFIYKKIKLNNFKFIKSVKMQFFIFKIINSFNKNVFCNKI
>gi|116334959|ref|YP_802454.1| hypothetical protein CRP_057 [Candidatus Carsonella ruddii PV]
MSFAIRYKKERFISFLKRFKKSINRKVIFINKKKNVKNKILKKIK
>gi|116334960|ref|YP_802455.1| putative DNA primase [Candidatus Carsonella ruddii PV]
MNLKCPFHNDTNASLSIKNNFYICYGCKKRGNTTFKFLSINNFDNLFNKNTLFIARNNLLFKKNCWLNYL
IKRNISFETLLKYNLGYANIDFKYNNKKKMLYNRLIFPILNETGILIGIGLKSKQNKPKYINLLKFNFNK
NELIYGIYEKKNNKFVIIVEGYFDLLTLYENNIYNAISLLGSNINEYKLLFILKKFKEVFFCFDGDHSGY
LGVLKLSFFKKKHKIKNLLFKCLPSKYDPDLYINKFGIKEFLNYLKI
>gi|116334961|ref|YP_802456.1| putative RNA polymerase sigma factor rpoD [Candidatus Carsonella ruddii PV]
MILKIKLKNKNYKNIKNIFNKFCFKKKKKKFFLKIINTKNLFNKITILRKILLKYIFRIKIFRFFFKKIN
CFFFFLNFIYKNTIFFKKRFKINFKILKIIKKNFLKKKIFFNCFSIFNNKINYFLNKNYFIKMLIFIIYK
IKISIIKKNLIAFKKKIKKYKNLITKEEQRENYLIFKNLIFNYNFCENKFHINFNWKIKNKIIKNKLKKN
IIVLKNNCYENIKIYNEPKKTLFIREYDNRNLNNLIRLIILELPKKEQIIIRLRFGIGFPKSYTLEEIGL
MYYLTKERIRQIELNVLFKLRHPTRSEVLKPYIKLLNTEE
>gi|116334962|ref|YP_802457.1| hypothetical protein CRP_060 [Candidatus Carsonella ruddii PV]
MLKKNKKILTKYFIIKTFIAGMILKSNDILIIKKNILNINDYIIKLSDNNINLINKKKKIILLLNKREQN
IILYYNYNKNYKCIPIELFKLNFLFKLKISIVKKGMTGFDIINTKF
>gi|116334963|ref|YP_802458.1| chaperone protein GrpE [Candidatus Carsonella ruddii PV]
MEKEFSLIIFLERLKHLEEKFNKFLTDTKNICIKTISELNVIKENLINDILLELIPLNDSMEMFSKSFKI
NQTGEMEILVLIFKLINKFFYKFEVKQISKIGISFNPEIHEAIGMYPTNLINKKNTIKHVLQTGYKRKIK
LLRPALVIVYN
>gi|116334964|ref|YP_802459.1| chaperone protein DnaK [Candidatus Carsonella ruddii PV]
MSKIIGIDLGTTNSCIAVLSNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPKNTLYAIK
RLIGRKFKDDIVQKDIKMVPYKIISSENGDAWVEVKDKKLAPPQISAEILKKMKITAENFLNEKVTKAVI
TVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKKNDRIIAVYDLGGGTFDISIIEIANV
DGETQFEVLSTNGDTFLGGEDFDIRIINNLIYEFKIENGINLSGDSLAMQRLKEAAEKAKIELSSVEQTD
INLPYITADKNGPKHLNIKITRSKLESLVEDLILKSLKPCEIALNDAKISKNKIDEIILVGGQTRMPLVQ
KMVSDFFEKVVKKDINPDEAVAIGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGIMTPLIEKNTTIPT
KKTQVFSTAEDNQTSVTIHTLQGERKKALQNKSLGKFDLNNISPAPRGVPQIEVSFDLDANGILNVTAKD
KKTGVEQSIVIKSSGGLSELEIENMIKDAEANLEIDKKFEELVKCRNEADSTISIVKKKLKDENLKILDE
ERVSIEKSISNLELLIKGDDIDSIKKENEELLKLSDNIIKKK
>gi|116334965|ref|YP_802460.1| hypothetical protein CRP_063 [Candidatus Carsonella ruddii PV]
MIFNIKKLLIKKKNFILKVRKICLFCYNYFFLKCKNCFFLNLIKIKYFFCEKCEINSNLLCNKNKVFYIL
IFVKKKIKRRDELFLNYKEINSKILNKVIIKYND
>gi|116334966|ref|YP_802461.1| dihydrodipicolinate reductase [Candidatus Carsonella ruddii PV]
MIKIFIFGITGKIGKTILNFIKLNKNFILLGGINKKNYKKFINNKYNFIFKLMTKNSVIIDFSNHYMIKK
ILFVSLYYKISLIIGTTGFNFKELKCIKYCSKYIALILSYNMSIGINILNLFFLNLNYFFLKFNFNSIII
DIHHNKKKDKPSGTALILYSKLKNINLNIFSSRIKNIIGNHIIYLISNFEILKFEHYVINRNIFIIGIFY
SIIWLMNKKMGFFSMYNVFFSC
>gi|116334967|ref|YP_802462.1| truncated carbamoylphosphate synthase small subunit [Candidatus Carsonella ruddii PV]
MLILENGYLINCLRINKKNIFGELSFSISNYGYIESISDPSYKGQILILTNSYIGNVGYINQDIQSNKIY
INTIISNNYSISSNFRSNFKLFDFCKKKKIQILTNLNTRLLIYLIRNTGSQIGCTIITKNKKNIILYIRS
LTLKKILYD
>gi|116334968|ref|YP_802463.1| truncated carbamoylphosphate synthase small subunitt [Candidatus Carsonella ruddii PV]
MINLLIINLGTKLSLLKKLVSNNYFIIELKDEFYLKNIDGLFISNGPGYPKNFLKYKNIILYFLYYNIPI
LSVCLGHQIISILNKFKIFKLKIGHHSCNHTLYNDFENKIYITLQNHNFNIKKKNQKNLINNFKSLFDKT
FQNISSLIFPILSFQNHPEGCSGPNDLILVFKFYKINNE
>gi|116334969|ref|YP_802464.1| carbamoylphosphate synthase large subunit [Candidatus Carsonella ruddii PV]
MNKKILVIGAGPILVGQACEFDYSGSQSCKTLKEENFNVILLNSNPATIMTDYEIANTVYIEKINKNSLI
KIVQIEKPDFILPTMGGQTALNCILDFINSEYNFPENKILGINKKILMNAESRLIFYKLINNLNLKCPDS
VIIKISNLEEINNVNFPCIIRPSFTLGGLGSGIAYNNKSLNLILKNAFLFSNEVSLDKSIIGWKEFELEL
LIDNYNNIIVICCIENIDPVGIHTGDSITITPAQTISDKEYQNMRDSSFIILKSIGLKGGGANIQFAINP
INGDLIVIEMNPRISRSAALSSKATGYPIAKISTKLSIGYSLLKIFNNSKYGKFISGYEPCIDYIAIKIP
KFNFEKYLELNFLNTVMKSIGEVLGIGFSFQEAFLKAIYSVFENNKIPSFLKNKFYNLYKNKAIKKIINS
NSTKIFNIIDLFRLNVNIKFIFCVSKIDPWFLFNIKKIIEEEKFFFNKIKNNNLNYKKIDLCSNEFEKPS
LYYYSSKNLYFNELRYSIKKKIIIIGSGTNRIGQSIEFDYCCAKFSKLIKKIGLISTMINCNPETVSTDY
DTSNYLFFEPITIFFINNIISFIKPILIICQIGGQSPINYLIKNNKINKIFFGFDKNNIFFGKKKKFNKV
LYILKLNRIKNYNCININDLILYFNIFNKTIITRLPNIIGGALMKILCNNKEFLDFINFNNIVNIYIENF
LLDFKELDLDVLVENGKIIVLSIVEHIESTGIHSGDSSMIFPSYSLSSKIIKKIFFIINIFCYKLKLNGI
INFQICFKKKIYIIECNPRASRTVPFISKSNKYTLIYNYVLILLGYNICFIKKKSNFYFIKSSIFPLNKF
KMFKLSPEMKSTGEEMNSGLSIQECFSKLFLLSDKTVFLNTKNTYIYIKYLKKINFKLKTNSFKKKINLD
LHINSYVLKRKNNMYIISDKLNILSNDMFSNKNTIIFFLSSFDKKFLLVRKLNKI
>gi|116334970|ref|YP_802465.1| putative translation initiation factor IF-2 [Candidatus Carsonella ruddii PV]
MDNIKNIYIDNKVLIKDLSFLINKPIEKLIKDLFLNGIFVKLNDYLFFENVKKICKKIYNIDVFKKENIK
ILENNNKLNKRTDVIFITVTGNVNNGKSSLIDFILKKNNVKFEVGEITQNISVFNFFFFEKKIYLFDLPG
HSLFSKLININLSISDIIFYIISYEDNIDYKKINDTIIKFEKLSISIILCINKYDKFKFGKKYLNFKNEK
IYISAKTGFNIKKLINTSILIFNKKNKYIDLNNPGKGIIVNSCFKNDVLITTLFIFKGTLETGNFLNFKH
ISIKILEFFVNEKITSKIESPNIILIKNIQFPIEVLFEISNTRKNYFIGIDYKDKYYNFTNFYIKVSTHN
MGFSIMNFYNDLKLNESINIVKLSIGVLNDNDINYCLNFNCIIITVGILISSVLKQKILINKIKFKEFDL
VNDLIDYFKNFYKCNKIEKTIGKLKIQEIFPSGKLNKIAGCKVIFGEVNLKNNIKIYKNLKLIFKGKIKS
IKIKNQTKEIVILNEECGILIKNFNNYEVGDIIESYIYEYDKKYIE
>gi|116334971|ref|YP_802466.1| hypothetical protein CRP_069 [Candidatus Carsonella ruddii PV]
MSMIKNILNNKGFGDPKIQNFFLIKRLKKIKNHFLINKKDLKCKIVISKLLCKIKKNINYMKNKL
>gi|116334972|ref|YP_802467.1| tyrosyl-tRNA synthetase [Candidatus Carsonella ruddii PV]
MIYLNNIFEKIFIKNNNSKIIKFGIDPTFFSIHLGHLFIINYLFFLIYKKFIIIIIIGDYTTKFKKKINL
KNLIINSICLKSQIKNILGEIDVVFNSIWYNKFNLCYFINLINLVSIKNYINKTLKNNLSKKISNYIYPT
IQSYDSVFLKSGFEIGGLDQLLNIICGRIFQSKFNIKKQNIITLKILSINNIKISKSKNKHLLNAYKQIY
NFKLLKLVFFNFKNYNKCVYKKTFFLNLVLLKKCKIFFFKKKIYFLNRNFISFYFKKIFNLKKFNFYKLI
YNKNIIINKKILIKNVYFRKHIFNIKNYKILVYDKFYKFVLKKKK
>gi|116334973|ref|YP_802468.1| glutaminyl-tRNA synthetase [Candidatus Carsonella ruddii PV]
MINFISLYLKKKNNFRFPPDPNGNLHFGHTFSIFINKNLSKIKKGNFFLRFDNTNLINNFSFFYKNIKND
ILWLNLKWNGKILFFQNKINIFYKYLIIFFKKKKCYYKKKKIINRFFLNYIKKLNVFECFIFKNNFYEKY
NFVILIKKKIIYRKVKKQRHWIINSTYDFSQPINDYLNFISISICTNEFKNNSKFYHYIFKKKILPIQIE
FKKKNFKNTKISKRKLKFNKIYNFFFLRKIGITPKILKIYTNIIGISNKNIYFKKKDLKNSIFFELNYLF
KNCCYFNNFIKVKNIKKNIVISSLFNFKNINFYFFNIRFNFFFFIKKTYYKKLKKIFLNKKRFFINKKKK
ILIVLIKLIKNKYINNNIDKNHYFNNKKKLLFKKQLISNVN
>gi|116334974|ref|YP_802469.1| ATP-dependent Clp protease proteolytic subunit [Candidatus Carsonella ruddii PV]
MIFLPTVIDKNIKGDRFLDLYSKMLKERVIYLNGAIEDTMASLIVSQLMFLDSENSKDIILYINSPGGVV
SSGLSIYDTIQFLKSDVSTICIGQAASMAAVLLAAGKKGKRFCFPNSRIMIHQPLGYAQGQASDVEIHAR
EMINIKQILCEILSSHTNNSIFQIFKDTDRDNFMNCKQTLKYGIIDNVLYKKWI
>gi|116334975|ref|YP_802470.1| ATP-dependent protease ATP-binding subunit [Candidatus Carsonella ruddii PV]
MFCIKNGYKSINFSNYLNPEKIKLELDRYIIGQNETKKIISVAVYNHYKRLFLIKSKKILLEKSNIILVG
PTGCGKTLMVKTLAKIVNVPIICVDATSFTEAGYVGDDVESIIQKLLHECNYNVELTEKSIIYIDEIDKI
SKKTDFFSGKDVSGEGVQQSMLKLIEGITLSIPSLVEKKNSQQIFNIDTTNILFIVGGAFSGIESIINFR
INQELNFIKKNFELTDIINYTSSEDLINFGIIPEFLGRLPIIAKFKELSESEYIYILIKPRNSLIKQFCY
LFLVEGVNIKFTFNAIKEIARIAVKRKIGARGLKSILEFVLLKAMFIFPSKNNLKLILIYKDVIVLNKTP
LFIYK
>gi|116334976|ref|YP_802471.1| hypothetical protein CRP_074 [Candidatus Carsonella ruddii PV]
MYTHVSSIIFLKILKLIGISFFFTKNGFNHRKIYIIDKSLIFFGSMNFDNRSIYLNFESLFLITNKNFIK
IFLKSLFIKINCNFYNYKKKKIVYKILYIVSFLNYLNI
>gi|116334977|ref|YP_802472.1| aspartyl-tRNA synthetase [Candidatus Carsonella ruddii PV]
MNNNIFKKENFFILYGIIKKIKKLGKIIFIEFISFSKKINFLIKNIKIKIFNTITGIYFFNNNNLNIFEL
CYFKKKINKINLKFLKLKSKIIYFIRLFFSINNYLELDIPIIEKYTSSGSKQFLIIDKNKKKYFLSLTQS
PQKIKQYYMFNAINKYFQIAKCFRDEDSRSSRIKEFQQIDIENSNTIFLNFKKKINLFLKSLIFFILKKK
TLILKIKYKFIKKYLFEKKNLNLPYLYKKKIIKNSYIYILKTKLKKIEINKSFYFKLSKYYIILTLKKQD
YNFCLSLKLSHKYNNLINLNIILLWIIDFYYFKNKKIKHHQFTAFKNNFKNFYNSKSLAYDVFLNGIEIG
GGSIRNINFLIQNKIFLNSKKKSKFINFYKRALPHHCGIAFGLERIISLLIKKNIKKTITYYNYSKLIKS
KKINE
>gi|116334978|ref|YP_802473.1| ribulose-phosphate 3-epimerase [Candidatus Carsonella ruddii PV]
MIQTLLSKIKCYHFDLMEFSYVKNNSFSINEINSILLILSKIMNIKYEVHVMSKYLLLSKIDKNKSINHL
ENKMYKINNIALSTNFCWNYIKYFNYNNILIMSVIPGFGNQKFLISTLNKVKKKINIDGGVNCYIFKNIK
NYFNKIIIGSNIINIKNKLSFYKINFILNEFKI
>gi|116334979|ref|YP_802474.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Candidatus Carsonella ruddii PV]
MNNLQLLNIISKYYLIEENIYLLELLKNCNFTNDFFNKVKKISLNLVNETRKNIHLDNLDNLLGEYNLST
KEGIQLMCLAESLLRIPDFYSADSFIKDKISFQDWSYYYESDYWKIIFYNMIIDFCSVAYYKHYTKNKEI
FIKIFKRTVVFFSNYVMKHIGKKFVYSSNIINAIQKSINDKNKYSFDMLGEAALTYYDARKFFFQYKLAI
NEIKKCYTEHNLNERLPSISIKLSALNPKYSFYNIEQITRDMIPLIKILIYNAKEAFVSITIDAEEVDRL
ELSLILFNNIFYSKICKNWEGFGIVVQAYSKRAIPILYWLNYISIEQKKIIPVRLVKGAYWDYEIKYSQT
LNLPMYPVYINKFCTDLSYLLCSMYMLSNLCKKNIFSQFATHNIQTISFILSLSNDKNYEFQKLYGMGND
VYHSLKKIYNITYREYAPIGKYKELLPYLVRRLLENGANSSFVNKIIDKNVNLEILSKNPFKINNKKYNN
KIPLPTDLFGGIRSSIYFYNLNISFHNYNFYKKINLFTNKKWIASSFISNIKRKTIVYPPFNNYSVIGLL
KHDLSINNSIKILKKSFNFWKNISIFKKNKIIKNFVLLIKHNFIELILLCSIEAGKTIIDCISDIKEAID
FCNYYCNQSILLNKKVFLPCTTGENNIYMLEGKGIFSAISPWNFPVAIFCGQLISALLSGNVVLVKPAES
TSLIACKLIKLLFKAGIPISVCQLIIGSGFSIGNEISFHKEICGIIFTGSNEVANTISKNLIMRKNAPLY
KLVAETGGINTLIADSTALIEQVVYDVVESAFKSCGQRCSALRLIYINENIYFDTLKLLMNVLLNINVGN
PLNLFYDIGPIITKKNFFNLNKYINTYNKKSVYSIEEKPILGNFLNPTLIRINNINDLKNEQFGPILHVS
IFKNFQIDQIISDINNSKFGLTLGIHSRNEAFCKYLSNNLKIGNIYINRNIIGAIVGMQPFGGCNLSGTG
PKAGGCNYLLSLVNEKTITINTTAQGGNVILLNE
>gi|116334980|ref|YP_802475.1| 2-isopropylmalate synthase [Candidatus Carsonella ruddii PV]
MFSWTSNYLYKKPIWVSEDLRDGNQSLINGYNLKNKINIWEFLIEVGFKQIVLGFPSSNKHDFNFINYLK
KNRLIPNNVFVSVLTPAKTNSINLTIDSLKGIENSIIHLYNSISKIQRKLVFKMNKNEIKNFTINFFLYT
ISKIKKKNIIFQYSPESFSDCELIYSKKICYIFSYLCYINNVKSIINLPITVENILSNKFVNSVLYIKKK
KFNSLLSVHTHNDMGGAITSSILSLLSGIDRIEGTLLGNGERSGNSAIMILASNYYNLGIDPGINIFNNK
IFYFLKKNNKSRIPWYSNLNYVAFSGSHQDAINKSYFKKKKFNWNIIYVPINPKIFNFKHKNMIKINIQS
GKGGLKFVFNYNYKIKLNKLILIKLYFIIQDISEYLMTEIYKEMIFSILIIRSNLLFIKDFKIIFLDISF
LYNFKIIIIVLKKNKKKTIKIINYYNE
>gi|116334981|ref|YP_802476.1| chorismate synthase [Candidatus Carsonella ruddii PV]
MNNSYGEIIKISTFGESHGLIIGALIDGFFSNLYISEKFIQKNLNLRKPFTSLFSTQRREQDKVKIFTGI
FKNKTTGAPVLMLIKNNDKQSSDYNNISLNFRPGHADYTYFLKYKFRDYRGGGRSSARETACRVASGCVF
KNLIYNKGVIVRSYIKKIGFLKINFKYWNYTLNRFFSNLLFINEIKDIINNCKNSCNSLSSEIVIIINGL
EPSLGDPLYKKINSTISNYLLSINATKSICFGFNFKNKNSFQVKDEIKNSGFTSNNNGGILAGITNGQPL
VIKILFKPTSSTSRKIKTINEKLKNITNKTYGRHDPCVGLRAVPVIESMLYTILINKILKKKIYE
>gi|116334982|ref|YP_802477.1| 3-isopropylmalate dehydratase large subunit [Candidatus Carsonella ruddii PV]
MNKTIYDKIFESHVIKKYNNLYILYIDKILLHEVTSPQAFMSIGKKILWNKSSIFSTSDHNVSTNFKHRF
FYNKNLKQLKCLKKNFKKFFFKYYDINSPKQGIIHIIASESKILLPGMIAICGDSHTTTNGALSLIANGI
GTTDIEIGISTQCIIQKKLKNMKIVINNFLNKNVTSKDLILFIIKKITSKGGTGYSIEFKGDCIKSLSIS
EKMTLCNMSIEAGSKISIISPDVKTINFYKKKIKNIKKFINYLKQIKSNKKSFYDKTFYYNAKNIYPHIT
WGSNLDTIIELDELVHSDNFKMLKYMNLKSNNSLYKIKIDKVFIGSCTNSRFEDLLVCSKLLLKLNKKKH
KNVIAYVVSGSENIRLKCEFYGIDKIFKKYDFIWKNSGCSMCLAMNEDKLKPGERCVSTSNRNFVGRQGY
KSITHLSSPIFAVISAIYGEFINFKLYNLITNDFDF
>gi|116334983|ref|YP_802478.1| 3-isopropylmalate dehydratase small subunit [Candidatus Carsonella ruddii PV]
MILISKFLILNINNIDTDLIIPKQFLKTIKKTGFYYCLFYDLRYLINQNNIFLNYDFPFNIKKNKNAKIL
ISRKNFGCGSSREHAVWAIKDFGIKIIIAESFSDIFYDNSFKNNLFLIKLKNFEINFIINNYEINIIYIN
IKNQFLKFNNKLFYFNINNLYKNILLSNFSIIDFLLEKKDIIFLFYKR
>gi|116334984|ref|YP_802479.1| 3-isopropylmalate dehydrogenase [Candidatus Carsonella ruddii PV]
MINLLILPGDGIGPEIIKQVIKIVKSCIYTGYKINIIYNYIGGISIDKFNTPITNNLISIIKYIDTIFLG
CVGGYKWNHSIFKPEYGLLKLRKKFNFFTNIRPIKCPFKNIDIIIVRELNGGIYYGKPKGFSKQIINQIP
TWYAYNTKIYNEQEIIRLARISFNLALNRKKKLCSIDKSNVLETFKLWKKTINYVHKFYNKVKLSHIYID
YATIDLIKNFNKFDVIITSNLFGDIISDLCSLLTGSLGMLPSISINNKSLSLFEPCHGSAPDIANKNIAN
PVGALLSLVMMFEYVLNDFKLSNNLYYSIYKVLSYGFCTIDMKKYIRNFKIVSTEEFGDLVNHFFIINV
>gi|116334985|ref|YP_802480.1| aspartate-semialdehyde dehydrogenase [Candidatus Carsonella ruddii PV]
MFKLGIIGWRGLVGSVFINRIFTSNIIKYLEIYLFSTNKILNFNLNNAFNLNNLINMKFIVCCQGSNFTK
KVLKLLLLKKWSGYWIDASSYLRMNKFCTLIFDPINKINILKNIKNQKIYSGSNCTVSLCLLTFSNLLKL
NLIDWIIATSYQAISGAGSKLINELVNNINKSHNLSKNLLTLEKQTKQSFKKENPILFNLIPWIDKKVKF
SQTKEEWKSSSEASKILNRKILIDSNCVRVSSLRCHSQLFTFKVNKNISINDLYYIINNKFIKIIKNNEI
DSTKKLNPFNVSGNLSLFVGRIKKSLIDNRIFSLFSIGDQLLWGAAEPLKRFLEILIEELL
>gi|116334986|ref|YP_802481.1| seryl-tRNA synthetase [Candidatus Carsonella ruddii PV]
MKYKIILINSIIKKENFSIFNFNKKNKNFFLKKKLNFFFKINFTNYNYIYNTFNNYNKNIIYSNKKKNFF
LKIPNLQRNCLISKITSSIKYNLSNFFFCCLNKIIDFYLTKILSLKFRYNEINIPVFINYSNLLFSGQLP
KFYNFLFKIENKKCFLIPTSEVILNSLSFFLKKKINQIKIFCNSLCFRKESYNLQNSSGFKKQNQFKKIE
IYQFINKNISLIVFYNMCSTIFYILKSLNIKFKIIKINNFELNPNTFYSFDFEIYINNWLEISSLSLCLD
KPFFFYLKKKNMHIINGSCFPIGRLVLAILHYYRLNNRIFKVPKKLNKYLTELLKW
>gi|116334987|ref|YP_802482.1| hypothetical protein CRP_085 [Candidatus Carsonella ruddii PV]
MISTIEKIKNKIITINIYNFLIKLGTQKKSFLKNKYLLKNCLINTWIKIIIKKKIFLFGYSNSLILSGLI
KIISKVINNNIKLNVNIFLKYNLLKIIKIKNIITNVKQNNFNSIVNHIKFKIK
>gi|116334988|ref|YP_802483.1| hypothetical protein CRP_086 [Candidatus Carsonella ruddii PV]
MNIINLFNYRFYISDSCYYYLFNNIKNNFYYKIFIKNKGKKNSKVFLYYSYYKKNLFSKLIKINKINLII
DINSICFLKNLFIHYKKIILINAPFLSNNMFLENKILNKIFFLIKCIINKKLILHNGAIKIDIFNFKKKT
LLISFIGNCSTCSISKNTFNNFILKMFKKIKFIKKILI
>gi|116334989|ref|YP_802484.1| DNA polymerase III epsilon subunit [Candidatus Carsonella ruddii PV]
MKRIIFLDVETTGLFVEHGDRIIEIGCVEVINGHLTGRVFHSYFNPEVKITQGAFNVHGIKDDFLLLKPM
FYEKINEFIGFINNSTIIAHNAKFDINFINKEIYLTNFKIKKIQNYANILDSLLLFRKLYPRKKNNLNDL
CLKFNLIKNKKRIHGALNDAFLLAVLIIKTGFIEKDFCIEI
>gi|116334990|ref|YP_802485.1| hypothetical protein CRP_088 [Candidatus Carsonella ruddii PV]
MINLSILKNKKLKKFIKIFSYLYEFSIYVKKKNNNLKKSKIIFYSYLILNFFFKIIYFKIKKKYFFILIT
IYFKNFILKKKKKILYKNIFIKLKRKQLICYYKKKNLIKFVNLKKKNVIKNIFQKKIFYKKSIIKRFFFT
KIKIFINYGFIIIKKKKNWIQYESPYWIYFCKKKIKFFLKFFVLKKKKKYLKRYLNLNLFFKNYKKINYT
NLFFLKNNFLIKNFFLKKYIFVNKLNFLNSIKKNKKNCYNINYNIYKNKIYINLISKNICFSKNLKNIFF
FFIFNNINCEFINYNKKKFFFVIDKNINCVGFFKFLKYCKTKIFEFSIKKKSKFKKKIRFSILIKIVFLN
FLNYLFNNNKLIIIKEKKYNKYLKSGIINLIVKINEIKIFFLKKMYYIFNININL
>gi|116334991|ref|YP_802486.1| putative phenylalanyl-tRNA synthetase alpha subunit [Candidatus Carsonella ruddii PV]
MLKFLSFFLKKKIYYKIRKTRFPFTINSYEIDIFYNNLWIEIIGIGIINNNILINNKLKTLGFAGGIGID
RLIMIKKSKKHIKYIYD
>gi|116334992|ref|YP_802487.1| ribosomal protein L20 [Candidatus Carsonella ruddii PV]
MTRSKPNKNTKKYLKHNKGFYGRKKNCLKLAKQYYIKSLFKKYIDKKNKKRLILKKKIALINFFSRIYFG
LSYSKFVYILKINNCKLNKNIILFLLLKTIV
>gi|116334993|ref|YP_802488.1| translation initiation factor IF-3 [Candidatus Carsonella ruddii PV]
MIKKLVLYNVSLVKKNEFFSFKNFLFITNIIFLLKKIKKKLFFFFSKKKKTFIYIFNFKKKKKKIKKKSR
FGKIKEIRIKINIDTQDFKLKIKKTNCFLLEGYSIKITIIFKGREIIYKEKGIELILRLQNEIKGVYFKF
SDIELDGKHLYSYFIPKNDKRKKKKINKKKVINK
>gi|116334994|ref|YP_802489.1| superoxide dismutase [Candidatus Carsonella ruddii PV]
MLEIFNLKYKKNNLYSLNQFNLHFSFYNDFKINLNNFLLKKKIIYNHKYELIDLIHDLSDIDKYKYISLL
GGYLNHDYYFKNITFNKNFIFGNIKKIIELNYINYENFKFNFINKFVDHIGWGWLVINKKKICLLKTKDN
NNPMFSISLGGFNSIPLIGIDLHEHSYYIDYNNNKKQYIKNFFEYLNWYEIENRLQNYNLNY
>gi|116334995|ref|YP_802490.1| hypothetical protein CRP_093 [Candidatus Carsonella ruddii PV]
MKFKIYKTNLEIGNYLYNFNLFYLIHKFYYFNKLSFYKNKKLFLFNFIKMNKYYFFYFLANTYIYFNNKF
VYNYIINSYNKYIKIIFEINLKNELKKVNLDKKIIIYLSEIRNFKYNKTFILCCKFKKKYVKHFGLSFYR
KKAENNSYRNLFKTILL
>gi|116334996|ref|YP_802491.1| phospho-2-dehydro-3-deoxyheptonate aldolase [Candidatus Carsonella ruddii PV]
MFSLISVKRVIIDLPKVFFSKKKSKLYIIIGPCSVSNIKDFYFYINKLKKIFTKNYVVIIRIYYEKPRSS
IGWKGYIYDPYLDNSYSIIDSIYILRNLMINIIKKNMLIGVECLNFYLTNYFIDLIFWVCLGARTMLSQI
HREYCSNLKCIVAIKNELSGKISYLKDTFIAISNKHYYIDFSNNRKFTSSLGNLNCHFVLRGGNLPNFVN
LNKLDIKPLIVDCSHMNSNKYAINQLYVYENVLNQFLYLKTNIIGFMLESNLNFGKQTLNNNFIGVSITD
SCINLKFTKILILLLNNINVKL
>gi|116334997|ref|YP_802492.1| hypothetical protein CRP_095 [Candidatus Carsonella ruddii PV]
MAVPKQKKSKSKSRFKKKNFLLKNKIIAKNQYNNYFIKHRCLV
>gi|116334998|ref|YP_802493.1| hypothetical protein CRP_096 [Candidatus Carsonella ruddii PV]
MFNFINLYIKTLGCNINTYISSKIIYNIKYFKIKILKNFLKSNLLILNSCVVRKNPQIKILKELKKWFFI
KKYKKIIIILTGCLTEFEKINSLISLKIDIVINSLSYIFIKKILNLYLKTKKKILLIKKKNNFNIKKNIL
NYISIMKGCNHSCTYCIIPQTKGKEFYYSFSYIFNYIINNIKKKTTEITLLGQNVNSYYNKNVNFNSLIF
NISKIKNIKRINFLSSNIIDFNKNFYNLYKNVKKISNHIHLPIQSGSNLILKKMNRKYNLNHYICFIKKI
QKIKFTTFSTDIIVSFPNENFFDFDQTLKVLKKIKFLDIYYFLYSKLRNTISFNFKENSFFVKKFKLFIF
QKSIIKNYYLLNNRVVRILVIGYISKNIFIGKMDNLKLVFFEYYKYNIIGKFINVKIIKIKKNIFLGLYE
NIYPCI
>gi|116334999|ref|YP_802494.1| hypothetical protein CRP_097 [Candidatus Carsonella ruddii PV]
MKIYILVYSLFKIKINIKNKNKKKKKIIIIIKKNKFIKYFKIKNSFFISNLIKKKKVINEIIILKHYCKN
KLLLHCFKHFFEKHHNSYIEVKINDLF
>gi|116335000|ref|YP_802495.1| leucyl-tRNA synthetase [Candidatus Carsonella ruddii PV]
MIYFKNPAFIENKITKNIKNIKNENFFCIPMFPYPSGKLHVGHARSYIISDVISRYKKLKKNNVLQSIAW
DAFGLPAENAAIKYNINPEKWTISNIKFMKKQLKYFSLDYSNLEFSTCDIKFYKWEFFFFLLLFKNNLLY
KKKEYVNWDNVENCILSNEQVNNNKGWRSNFPIKKVKIKTWFLKIKKYSSRLLYDLNYNNWSKKVKKVQK
QWIKIFFFFFLKKKKIYLNINNKIVNYNEKIYFKSKKIIFLIIKSFKTNIISSIKIFYYDKFIKKNSKII
ICNYFIKKKKIKIEYLNILINNKKCFFLKLSNLKNWSFLRERRWGSPFFYKKIKNNNFKNYKTVDTFIQS
SWYYLFYIKTKNINTKKKSYFLPINSYIGGIEHINLHLIYLRFFNKVFFDFKIINVKEVILNLINNGLIN
NNVYYKIKKNKILFCKYNKKAILFGIEKMSKSKKNGINPIKIIKKYGSDILRLYFITNKPINKNIIWNNC
NFIDIKNFILNLNKNIMLLDKKKSNIFYLNNVLNIKKIHTIISTIKKILLKNNSIIQLKIIIYCLYPIIP
NLSKIFWFKNGCKHPIEKFKLSLNYNKLYKLYYKNNFIKKIKNLNFFLNIKNMFHKISKIIISMDEISII
IL
>gi|116335001|ref|YP_802496.1| succinyl-CoA synthetase alpha subunit [Candidatus Carsonella ruddii PV]
MINNNILSYGITGKFGFQHTKVSINFGTKIKCGINNSKNGGIVFHIPIYSSAIKAVKSNNCKISVLYIPY
FVCKKTILENIYSGIKIIICITENISVFDILKIKYYCEKYKIIFIGPNSPGLILPFLKIRLGIIPISIIK
KGKLAIISKSGTLTYEAIKISSKIIGQSICIGIGGDIISGCNIKNIFKLVFLNKFTKKILIIGEIGGNFE
NVITTCKVNKKIFFYIVGIFSPLEKKMGHAGAINRVNNDVLIKIKKIKKKHIVLNTLEEILFIK
>gi|116335002|ref|YP_802497.1| succinyl-CoA synthetase beta subunit [Candidatus Carsonella ruddii PV]
MNLCEFESKKILFKYNLPILNSYLTSNYTYVKNYIYKIQVNLNYRKKKGGILIPHSKNELKVFYKKWKKT
KFNNKKIKYFLLEKISKIEIEFFLSFFVHDNNLTIIISNKGGINVELENKNYFLKLNIKTFIVFYSIYDY
LLNCKIFKKNILSILNLVFKLYKIIICNNLLLVEINPLIVYKKKIYILDCKIITEKIKKENFSDNISNIL
KINYIKLKGNICCIVNGAGLALKTLDILSFNNLKCANFIDLSGSITEVNINNLLKVILIDKKLNFLLINI
FGGIVSCEKILIGFLNIFYYDFNFKIIIKLNGLKSKLALKKIIILKKIIIIKNYKKLFYKCKITR
>gi|116335003|ref|YP_802498.1| putative glutamyl-tRNA synthetase [Candidatus Carsonella ruddii PV]
MFNLRIAISPSGVPHIGNFFIIFINYILKNKLLGNVYLRFDDTNKIKNKNINKLYILKNLKKQGFYIKKI
LKQTSNLNFYYKKNIFKKKIIFKKNFFNIKLNNFSLSYSFFLFINFTKVKFYDNSYKNIKSTILDNKEII
IKKNGIPTYNFSSIIDDIFNNTFIIIRGKEWLNQLKNQVLILNCFKKYFIFHHLPNININNKKLSKRNKA
KNLNFNKIYKKIFFIKKKNINNTMFYNIYNNNNDIKISYLFKKKKIKKNNFIMNIINIINYLDPNIFKNI
YKMHHTVLNHVKKINLNLSIPNLNFLEKNLFDISSILSNLKFIDIKNIFTQI
>gi|116335004|ref|YP_802499.1| methionyl-tRNA synthetase [Candidatus Carsonella ruddii PV]
MYITSALPYINNILHIGHIFEMFYAEYNSLIYNKLNNFKVFSGLDCHGLIKKSNFKKIFKLNIIKINYFN
LNIDFNKTITLINKRICNWIYLFLNDNNYLFGNINKQLFNKEKRFFIPDKYINYICFYCKSKINDFCFKC
KNQKFLLKIKILKKNIIYRKTFNIYFKNYKFLNWNISRSKNYVGFLILSKINIYFYVWFDALISYISNNL
KFIKKKFLNKKLIQIIGKDILYFHKLFRVILKIIKFKNNKIIIHGFILILNNKISKSKKNNLEKKINVFY
FKLYILLKIKNKINDINLNIKDIIFCKNFFFKKIINLYFRIRTILNKFDNKTSEYFFVKKHHIELYSFYK
LNILNKIPKKKVQECINLNKILEKNIFWNNKNLYLTQIKCTFYMKKLISIINFFYFIINKNKIKKKILIN
SNLFNIIKFYEN
>gi|116335005|ref|YP_802500.1| hypothetical protein CRP_103 [Candidatus Carsonella ruddii PV]
MKIKNFLLYIFKKKKIKNCKKCNICTKICPLNLILIIKNNIFKNCKICNFCILNCPQKCIK
>gi|116335006|ref|YP_802501.1| argininosuccinate synthase [Candidatus Carsonella ruddii PV]
MKIKEKIVLAYSGGLDTSVIVKWLQNELNFEVITFTADLGQGEEILLAKKKAKLLNIKNIFVKNLKKEFI
KNFVFPFLRSSSTYENNYLLGTAIARPLIVKELMKISYYLNTNYVSHGATGKGNDQIRFELGFKYFNPKI
KIIAPWRIWNLNSRNSLLNFCIKNNIKFDSKTKKYSIDKNLFHNSYEGGNLDNINYEPDEPMWEHTLSNY
NSLDYPIYISLTFKNGDPIKINNKNYNVEELFLKLNNLGSIAGIGRLDIIENRLIGIKSRGCYESPGASI
IMYARKKLESLILDKEIYSFKEEIALKYSKLVYNGYWWSPERILLQKIIDYTQTSINGIIKLKIFKGQIN
IASINSINSLFNSKNSSFDEISNLFNQSDSSGFINIKSLRLII