Commit 6b722927 authored by Raquel Bromberg's avatar Raquel Bromberg

REFS and Examples added

parent ecf11784
This source diff could not be displayed because it is too large. You can view the blob instead.
>gi|154147865|ref|YP_001405618.1| hypothetical protein CHAB381_A0001 [Campylobacter hominis ATCC BAA-381]
MIYYPQNSILKKPQSFAELRGKYCQKGANMRKHTKHLLLKLYLNFRLFKLKVEVEIRK
>gi|154147864|ref|YP_001405619.1| putative RepE [Campylobacter hominis ATCC BAA-381]
MRLGSRQERGRKSPPFGSIKQSKGDKMAKLPVYYDNKMNLLAFKNLDKVEANLFFSIVARFNDKGAEKLK
LNFSEIAEFISDNKYTSKELSKLINDGVGKVVQSAIKWEMTPIKTAYFTLFNEFLVDDENKTLEASINSR
FLFMLNNFKDGNFTMLELAEFSSLKSKYTQTLYRLLKQFRFTGFRSIKWAEFIEIMDIPTSYRARDIDKQ
ILKPAIAELTQEADIFNQNNPIFKKLIYKKIRGTGRGRPVELIEFYFMPETDEPKEQKKNEKALQYIAQD
IKKEQMLKELKRSSQEPKKINPLTGQEITGLEPYRLRNMRFKNKFGEYDILKIQNIEQEPSGKIIVTVRN
VDDNHISTMKFDSLKHFENTFNLHQM
>gi|154147862|ref|YP_001405620.1| hypothetical protein CHAB381_A0003 [Campylobacter hominis ATCC BAA-381]
MRVLLSKRSVRQRVTSPYDLNFSIIFAFLERFPFNIFLNLTFNLLDPFLASAWWWFAWVFRG
>gi|154147861|ref|YP_001405621.1| hypothetical protein CHAB381_A0004 [Campylobacter hominis ATCC BAA-381]
MKSYKSIRKTIRFTDDEFSTIKEKMELGNYSNFTEFALHSMINKKPSKAKSINKEYLLELNRIGNNLNQL
TRKLNKGDRLNNLSLSAIIDIRDSINSLKEKI
>gi|154147863|ref|YP_001405622.1| mobilization protein [Campylobacter hominis ATCC BAA-381]
MIVKFFNTKKGGGNSAIDYLLDKRVEQGTSRILQGDEQLTRDIIKNMSQKHKTCVGVLSFEEKDIDEQLK
FKLMADFEKALMTDEAQGRYNILWVEHNDKGRLELNFVIPKIDLQTKKALNPYYHNADLSRIASWQDIKN
IEYNFKNPKDPSKEQTIQGSKKQVEIYKDYEKLDNFLQQEVKNGTLQSRAEIIKLLQDNGVEVTRQGKDY
LSIKLPDNTKAKRFKGGIYSDEFRSIESIRTIGDEQKEREREFSQRDNTAELERLRNQFERAYNAKSKYY
KREFEKRDRQHKNRYDNYRTGIDEFKANEHKADNFIDNSISSDFFSPISETSRSDIDDSVRNRIDERARQ
LREREQEAIRTAKRTRADYKPTQKEPIRLNEREYALLADNRKQQQEPIIDENYIREREKRKREAIKRIRE
LREARERQRNTELEASIKPSFERLREVREGIKQQHERHTIFADIFRQSEASFRKHITGRIQEFGRQFQRN
ITEFGETLREQGKRSIKSGIDEVRAFINKHKRELERVLEKGKTKA
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
>gi|189426690|ref|YP_001953866.1| precorrin-6y C5,15-methyltransferase (decarboxylating), CbiE subunit [Geobacter lovleyi SZ]
MQQPEISLIGMGVGGLDGLSGAARKAIMHAELLIGHPRHLALFSAHPGDKIPLGKLPDLLQLLEKTSKRT
AVLASGDPLYFGVGRFLLNHLPKQRIRIISNISSVQYAFALIKEPWDDALVLSAHGRKLTDILGRIADAD
KVCILTDQENSPKEIAQELLKQKSAPHTVWLCEDLGLPTEKATCTDLPSLLQLPCSDLNILIFIR
>gi|189426691|ref|YP_001953867.1| precorrin-6x reductase [Geobacter lovleyi SZ]
MILLLGGTSETAPLAAAFAEQGWPTLVSTATDAVLELPEHALVSRRHGRLNQQQMEELICREQIRLLVDA
THPFATAAHATALAAATSIGIPYLRWQRMGCDRYGEENISVTSHSEAAQRAVSFGRPILLTSGSRNLLPY
TKAATTADVTLFVRVLPHPESEHSCCEAGLIPDQIIAARGPFSVEDTVQLIQRYQIGTLVTKDSGVAGGL
PEKLEAARLTGCRVIIIHQPEQPDGIAVYNAIADITAALAAHQEQPCNNQK
>gi|189426692|ref|YP_001953868.1| precorrin-3B C17-methyltransferase [Geobacter lovleyi SZ]
MQAINHSSVVAGYTPYIESLADLTNGKELIVSGMMQERERCRAALQRAYEGATVALVSSGDAGVYGMAGL
ALEMAEAESLQVAIEIIPGISAANAAAARLGAPLMLDYACISLSDLLVPWERIRRRIELLAEADMVLALY
NPRSTKRVRQLEETVEILRRHRPATTPVGIVTAASSPDETITLTTLSGLLEQSVTMRSLVIIGNSDTRLL
NGLLVTSRGYSL
>gi|189426693|ref|YP_001953869.1| cobalamin (vitamin B12) biosynthesis CbiG protein [Geobacter lovleyi SZ]
MKTALITLSAEGLALLQKIRSFEPEADLYVHHAVTDLPTDAIPFSAVIPLTAEIFQRYRELVYAAPAGVV
VRALAPVLQHKLSDPAVVVTDLHGRWMVSLLSGHEGGANDCALRLANLIGAEPVITTSSEALKRIIVGIG
CRRGTSAERIMAAITEGVQLAGCRMEQVRLLASADLKADEKGLLEAASRLDIPLRIIPSDEIRHTARRFG
HSDFVQAKVRLPAVAEPAALLAGRRTQLLLPKTIIQGVTVAVAQEGCLS
>gi|189426694|ref|YP_001953870.1| precorrin-4 C11-methyltransferase [Geobacter lovleyi SZ]
MMVYFVGAGPGDPELLTRKAERLLRNAAVCIYAGSLVNPDILTLLPPDAERHDSASMTLEQTVAAMRGAA
ERGLDTIRLHSGEPALYGAIREQMNLLDQYGISYQVVPGISAFQAAAAALTTELTAPEVSQTVILTRTAG
RTPMPEKESLEQLAASRSTLCIYLSTHKIDEVSTTLTPFYGPDCPVAVVYHASWPDQQILRGTLVDIARQ
AAQAGLQKTALIVVGHALGRDIPASKLYDAAFSHEYRIATEP
>gi|189426695|ref|YP_001953871.1| cobalamin biosynthesis protein CbiD [Geobacter lovleyi SZ]
MSKELRGGYTTGSCAAAAAQAATLALYGLPVPPCIELTLPDNSRVLLTVEDLQYGKEWCAASVRKDAGDD
PDITNGSFVVATVARSSTGGIIFKAGDGVGTVTLPGLAVLPGEPAINPVPRRMIEQAVRQVTGDGLIITI
AIPGGRALATKTFNPRLGIEGGLSVLGTTGRVRPFSHQAVQETIRCSFAITLACGIKDPILVPGHIGARA
AERHFRIREHQLVEVGNEWGYLLKLAAVEPLERLLLLGHPGKLVKLAAGQWDTHSARSDSALPVVTRRCI
ELLGSAPDGTPTVEGLFQALEPAERLILGNALADDTVASIIRTFSPGFPVAAVLTDNNGDWLGSNGDLTA
WQGKESLL
>gi|189426696|ref|YP_001953872.1| precorrin-2 C20-methyltransferase [Geobacter lovleyi SZ]
MNCFERALPGHFYAVGVGPGAPDLLTLRAARLVETADVIIAPRSNKSDESLAVTAIRPLLDKQELIENSY
PMERNQAATRQCWADAADLAATRCKQGQSVVQITIGDPLFYSTSAYLLEALAELLPTEQIHVVPGISAMQ
AAAARFGTPLTIQDDRLILMPAVRLEQVEEALTRCETLVLYKVGPRLKELTALLAGHGLLERARLVCHVE
QEGREVIISRLTSNLPEAMGYMSTVIVQLGRKGWE
>gi|189426697|ref|YP_001953873.1| anaerobic cobalt chelatase [Geobacter lovleyi SZ]
MTTTTNQALALVFFGTTADAGLKVYDWIEAQMAARYPQMMVRRAFTSQMVIRRLKERGVTVPNLPELFSD
FKQQGVTQVAVLPFLIVPGQEYGKITAALAAEPGLKTVCAAPLLTTDQDIEAVICALEPEIPVGIPTVIG
CHGNEQHDQFNHEIRQFAAVIEARHPQVMVATIEGDNPGTAPLARAREMAQRSGAVHFIPLMLVAGDHVM
NDIMGDEEDSWKAQVGAATSTCSGPAGLNDQILALYCRHLDTAMQADFGGI
>gi|189426698|ref|YP_001953874.1| Precorrin-8X methylmutase CbiC/CobH [Geobacter lovleyi SZ]
MPSSPLIHSLLAQPLSGEQIEERSFACIDQEAAEHSFLPDQWQVVRRLIHTTADFGLMELVRFSPDAIAA
GTAALRNGKPIFVDSNMIRSGLSMARLRSVCPAYGPESISCHVADGDVAEEARRCGLPRSLFAMCKARAI
ADGGILLFGNAPVALLELNRMIIEEGVRPALVVAMPVGFVHVVESKDELMALGVPFIALSGRRGGSPLAV
ATLHALCTVTDQQAKGNP
>gi|189426699|ref|YP_001953875.1| cobyrinic acid a,c-diamide synthase [Geobacter lovleyi SZ]
MAQGAILIAGTGSGVGKTSVTLGLVAALKRQGLTVQTFKIGPDFLDPTWLALASGRPCYNLDGWMCGEQY
VRNLFAEKSADADIAIIEGVMGLFDGASPVNAEGSSAEIAHWLGLPVLLVVNSHGVARTLAATVSGFCSF
EAGVRIGGIIANQSGSGRHADWLAQSLSSASLPPLAGAIPRNALPTLPSRHLGLVTAGSAPLTPALLQEL
AEQIEQHLQLDVILELAAREHRLPPLSLPEAGGESAWNLPSLDKEGPGVVDTVRIGIARDEAFHFYYPDN
LEALSANGAELVLFSPIHDTCLPPGLDGIYLGGGYPEEHAARLASNSGMLDAIRAFIASNRPVYAECGGL
MYLSRGIELLDGSRQQLVAALPFHTRMLPKRKALGYVEVTLQQETLLGSAGQVLRGHEFHYSEIIEQDPT
IGAPPYQTVKRNLNNAGDCGYQQGNLLASYIHLQFAARPEVAAYFIQTCRSCHAIKPAYP
>gi|189426700|ref|YP_001953876.1| uroporphyrin-III C-methyltransferase [Geobacter lovleyi SZ]
MFLPLQIQMENRPCLIVGGSTVAARKCSKLIEYGARVSVVAPVFCDDPVWQSPQVSTVTAPYTASQLDGM
QLVIAATDDPAVNQAVLDGAASRGILAQRTDHPDAGDFLLPATLRRGSLTVSFATEGVNPAFSRLLRDHA
QNHYDDTYTRYCELMAAVRDGSAWQQLSKPQRKQGLRAMARCSVKVLSLLRSGQEDAAIALLETAAGIRV
TATVGGWPLVYLIGAGPGDPGLITVKGAQRLQEAEVVLYDGYANPLLLEQYCPFAEHIDVGKHKGGACPT
QAEINALLLAKAQTGVVVARLKGGDPLMFGRGGEEARLLAEHGIPFEIIPGVSSGLAAPAYAGIPVTDRE
FASSVGFYSMHKKEGTLLSEQEWQRMAQGPDTLVLLMGSTVLAEIAENLIRYGRAPSTPVALITKGTHPT
QTRYLATLATITALAARHRPQRPGLVVVGDVAGVAPAMDWFPCTTIRDET
>gi|189426701|ref|YP_001953877.1| cobalt ABC transporter, ATPase subunit [Geobacter lovleyi SZ]
MNYSELFRFTDVNYRYPDDSRGLINCSLSIKRGSRTAVMGVNGAGKTTLLQMLNGILRPDSGVVVFAGQP
LDYSRTSLRSLRSKVGFLFQNPDSQLLSASVREDVSFGPINLGLGAEEVNSRVGYALQTVGMAEYANRPV
HALSYGQKKRVCIAGLLAMQPEVLVLDEPMAGLDQPMQAELEAILDTLHQQGMSIILASHDGDFIYRWSD
HILLIADGNCRGNQETGRLSSSLDALAALGLGTPAVLKLYHALLEHQLIASTCPIPRSIDDLVTSIRQQS
AGMRSI
>gi|189426702|ref|YP_001953878.1| cobalt ABC transporter, inner membrane subunit CbiQ [Geobacter lovleyi SZ]
MLIDQNAYTNRWRQVNPAAKAVFGICGICAAFLAGQTWLAGTLALIIALITIVGAGIPVSQYLRAIAPAL
FFLGISAMTLLVSFDGSGITFTGVGHNQAMQLCGRATASITALLFLALTTPMSEIIALLRKLKLPDLMLD
IAVIGYRMLFVLLATVRQIQTAQAARLGYDGPRHAFRSLGQMIAAVTLQVWQRATALDLAAETRCSNGTL
HFITPVYADTGRDLTVALLGGTCMIILTLLVP
>gi|189426703|ref|YP_001953879.1| cobalt transport protein [Geobacter lovleyi SZ]
MKRHQNIALIIAVIVLALIPLFTVQRPAPGPDGKKVEIFAGADGEAEELIKKIVPDYKPWFEPFFEPASG
EIESLLFALQAALGAGFIGYYLGSSATRSKLQKEQNNTRC
>gi|189426704|ref|YP_001953880.1| cobalamin biosynthesis protein CbiM [Geobacter lovleyi SZ]
MHIMEGFLPVKHAVAWSAASAPFVAYGIYSIKKRVAEHPEQRMLLGVATAFTFVLSALKIPSVTGSCSHP
TGTGFGALLFGPAAMAPLGAIVLLFQAILLAHGGLTTLGANIFSMAIVGPFAAYGVFRLAQAIKLPFGLS
IFLAAALGDLLTYVTTSVQLALAFPDPVGGFAASFAKFASIFALTQIPLAASEGFLTVLVFNALARYNAR
ELQSMNLPVPQEVKA
>gi|189426705|ref|YP_001953881.1| conserved hypothetical protein [Geobacter lovleyi SZ]
MNKNSQFWFRAKTIGIGWGKPVTWQGWFVLLIYFLLIGISAFALKDSSLFIPMFVICVMLFSGTLIFVCY
KKGEK
>gi|189426706|ref|YP_001953882.1| hypothetical protein Glov_3663 [Geobacter lovleyi SZ]
MNQSPNFSTDITNQKPNSFLQRGFSLVYNIMHLVLVVFGVLLVLVVIFISVFSVNLAVRAKGALEPATYS
EVRTEIPSTIKQVHCNSGDIVAKDQLIVELTEDQYHNDLFQAEESLKAARAELLKTIRKYEMSYAVYKDV
IPTLSEKKVSEIPDIAILQSIVNKEEKQVEMRRKKVKKTRLFSPIAGVVVTPDLQKRVGTSIKEGETVAI
VADLSKWVVKAYVPERDIPKVRIGDTTKIKISAFPFMEFKVFTGTVTAISSIPMLKLNTEIMNQSADEKD
EKQQRYFEVTIDLADSYAKKNGQIYNFQFGLLAEIDIIRTRKKIIIYLWELLLGKLDVFGEIN
>gi|189426707|ref|YP_001953883.1| transposase IS3/IS911 family protein [Geobacter lovleyi SZ]
MMATMRTKRSPEFKAKIALAALRGDKTINELATLYSVHPNQITAWKRQAQEHLVAVFDSKKAKSSKADEK
LQEELYRQIGQLKVELDWLKKKSGL
>gi|189426708|ref|YP_001953884.1| Integrase catalytic region [Geobacter lovleyi SZ]
MTGSKKNLACSTARKRELIDWRHPTISIARQCELLGVSRSCLYYHPVPASNENRLLMRLLDEEYTRHPFL
GVIKLTNWLRSQGYWHIGTRRVRRLLRLMGLMAIYPGPNLSKPAPGHKIYPYLLRNVEVERVNQVWSADI
TYIRLKTGFVYLVAVVDWCSRYILAFEISITLEADFCIEALQQALTRGTPEIFNSDQGSQFTSPRHTEIL
HLAGVRISMDGKGRALDNIFVERFWRSVKYEEVYLHDYESVQEARIGLKRYIEYYNNERQHQSLGYQTPA
EVYFKGLLNEVDQLKNRDNNRHDQT
>gi|189426709|ref|YP_001953885.1| transposase IS4 family protein [Geobacter lovleyi SZ]
MQPKVQISDQGDLFRSRLDQMLDRQHELYRLADQIDWQFFEREFGPLYSVKMGRPGVPIRLLVGLHYLKH
AFNESDESVVARFVENPYWQYFCGFEFFQHRLPLDPTTLVKWRKRIGSKGVEKLLQATIATAVRRNDITP
QSLERVNVDTTVQEKAIAYPTDARLYHKARVALVKLAKERGIQLRQSYERLGKKAYIKHGRYKHARQMNR
AKRELKRLKIYLGRVIRDIFRKIANPDQTLTTLLERSRRIFNQKQHDKNKLYSLHAPEVSCIAKGKSHKK
YEFGCKVSIVSTSKDNWIIGTQAKDGNPYDGHTLKGALKQAAQITGITPGNAYCDKGYKGVPSSLNGTTV
HLANKRKSSMKPSEWAWYKRRSAIEPIIGHLKVDHRMDRNHLKGAEGDKINALLAACGYNLRKLLKLLLF
WLVKERTFLSWGRLSPIQLNTV
>gi|189426710|ref|YP_001953886.1| TonB-dependent receptor plug [Geobacter lovleyi SZ]
MNYRTIALPTAAVVLLAAGSVAAETVKGSPSSYALGEVVVTADRLDEYIKNYPQEVTNVTRAEIIKRNHS
NLEEILKTMPGVDVYPTSGMGTRIAIRGSGKSSGVLILLNGRPMNSNQSGGMELNAIPVELIESVTVFKP
PVPVWLGPGGSDGAINIITREIKRDTKGETLKSSIKAAGGSYGLLQTSASQALAVGDGNLLLTGTFNHRD
GRRINSDRNDGSAALNWNRSIKNGNKYEVNGRYYQAEYGVSGPIDNETPNARQQYRKGSIDGRISGALLE
TGSYTLNSYGDLLNLKDRSQQGYTATLDDRKVGLKLDTSWLDEQEKWEFRLGGMSEFDNYEHSLAGRHNR
FRNGLNAQFDKRFGDITATAGARGDITNDFGFTPGGVLGLGWAATQNTLLKMRVGYVTNVPTFEQLYQST
HGSIDQSRGNPDLKTEKVLSYDMSLEYRFAKNRQIQATLFRVDTWDLITSQRGADLIYRPINIAGAERQG
IEVTAKSSWESGFSGDLSCIYQSSKNRDTGKDLPYTPDIKLKATAQYTIPDVKTRLEASLRYEGVRYSPA
ENLVMQKMNDYLTADLRVTQPLTYKKIKADIFAKIDNLCNVRYQNHYGHPDDGIRALGGVQVRF
>gi|189426711|ref|YP_001953887.1| TonB family protein [Geobacter lovleyi SZ]
MDSQVKWYGISLGLHVGLLCVVLLFAGSALTSVPPISIDFTLATTTMPERQQGAQQRADIQPQQPQKPAN
QPVSAQPKPVQQKQLQTTPQTVAAAAPHTAAVMPPDTQAVNAVSESSSGTPTARGAANIVTHSVSQPAVI
SSGGTVSSGQAQQRYRAQHFTYIRDLIMSHLTYPQLARRRGWSGRVVLAFVVAEDGSVRSIHVKEGSGHT
LLDNSAVETVKGVAPFPKPPVAAEIIMPVVFRLE
>gi|189426712|ref|YP_001953888.1| Biopolymer transport protein ExbD/TolR [Geobacter lovleyi SZ]
MEEKEVSVINVIPFIDIMLVLLTIVLTTSTFIAQGSIPIQLPKAAKGASAALQGHTIEINRDGRLFLDGQ
PTSLPLLKQSLSAVDRAAPVLIRADRSLLLQGFVEVLDSVTQMGFKKLSLQTESING
>gi|189426713|ref|YP_001953889.1| tonB-system energizer ExbB [Geobacter lovleyi SZ]
MDWLKAAIDYGVIGLLLIMSVVAVAVALERKAFYRRLDSTKFTNKKELELALTRKLHIIATVGSNAPYIG
LLGTVLGIMLTFSTMGQQGFVDATKIMTGLALALKATAIGLVVAIPAVTIYNILVRQAKETLLAWEARNG
GERS
>gi|189426714|ref|YP_001953890.1| Cobaltochelatase [Geobacter lovleyi SZ]
MFRNNSDSISRRSLRWLVVGSSTYFVYACVAKFLAALRSSLNWNRKNAWLMLAALFAILLLPLPSDSAAP
AQPPVLARLILGDYNSSLAVKTVQTIRERHPELSAKVRFGVLTKGDAAALPALQPGSRGFSVVHIMDRRG
LEPFKPSLQAMMRQGMKVYAVGGMYGKDDKDLGLQNDRTVASYMQQGGLDNAVNMVLYLLQRDCGIAVKA
VPPAQVPQFGIYLKDGHRTVTSFAEYQRLYRSRPGPWVGIPFYKNLVDNGETALLDSLIDSLERQGLNVL
PVYGYPSEKTVEQFLFDENGKARVQVVVGISLKVGTTPQRAVPILTRLGVPVIDAVTLHSQSREEWEKSP
VGLDIFERSSSIGLPELAGIIQPTVVASKERIKDKASGMEYVETRPIPERIERLTQRVKRWLALQQKQNR
DKHIALIYYNYPPGKQNIGAAYLNVMPESLYELLARLKAEGYDAGVTAVSKDQLFDDVHAYGRNIGNWAP
AEIDRLARSGHALLLPVQVYKSWFMELPDRFRRSVIKDWGEPDQAKIMTWSDPKGRKFIVLPGVRYGKIL
FTPQPSRGWEQDIKKLYHDIHIAPHHQYIAFHLWLKRGFKADAVAHIGTHGTHEWLSGKEVGFTREDPPE
LLIQELPNIYPYIVDDVGEGLQAKRRGMATVIDYMTPPLDKSGMNREAKLLAALISDYTAAREKSPQLAA
AKLEDINTLARKTGILTDLKLTSISTPEQAEELDDYLKEIGEKVSPFGLHTFGRSPEAGYRRSTAEAIVA
IEKNLTPAEREKRIAALEQAIEASGKRELDSFVAALAGNYIPSGSGNDPIRNPDSLPTGKNFYSFDPAFV
PSPGTYNTGKKLAQELIDGYRKRHGVYPDKLTFNIWATETIRHEGVMESQIMYLMGVRPKWDERGRVQGV
EVIPRGELGRGRIDVTMVPSGLYRDLFPNLMDLLDKSVSTARDQQEVDNLIRSNVEKTRRMLLTKGVSEE
KAQRLASVRIFTEPSGAYGTNLDKVIVASNTWDNEKQVVDVYFMRMSHLYGQGFWGDSAEHNGKKLGDTL
LKNALSGSKIAIHSRSSNVIATLDNDDFFQYLGGTAMAIRAVDGKTPEVFVTNMTNPKQPVQETLEKMMG
REMRSRYLNPEWIKAMMKEGYAGARFVDKVTEHLWGWQVTVPEAVDAAKWQEMHETWVLDRNGLGIKDMF
RKSKNMWAYQSVVARMLETVRKQYWKPDSQVVEKLAEEYAKTVQEVGLACCDHTCNNPQLTEFTTATLLS
VPGLKPLAPGFKQALQNMKQPDAARSGQQGRQSAAQTTAQPSKQGASGAAPDGSGKAAKGKQVEGFEMKE
TGAQQSGAASAPIPWLFILGFVGLVGLIGFGFRRNR
>gi|189426715|ref|YP_001953891.1| conserved hypothetical protein [Geobacter lovleyi SZ]
MRYLKRRNRFDKYDEPLEDPISGVANLFDVSVVFIVSMMIALFMAYNMLDLMDPKSEVTITKKTADGKIE
VISKKGKEIKVRKVTDKRLSGEGERLGTAYQLKDGKVIYVPE
>gi|189426716|ref|YP_001953892.1| biopolymer transport protein-like protein [Geobacter lovleyi SZ]
MNILAGLETFLYLISSVLLFPVVAGLVLLVAWVAIFAGGFLREWIERRRNTSNPLERFQKQLTATLEEGG
ATPDLDLQAERLLQTAELAQIKSLDKIRFVIRVGPALGLMGTLIPMGISLSSLAQGDMPKMAGSMVTAFT
TVVVGLACSVLAYLMSLVKEKWVRADLREMEFFTEKTLRQRLGGPSEPAQEERSDALS
>gi|189426717|ref|YP_001953893.1| conserved hypothetical protein [Geobacter lovleyi SZ]
MDLNLLLWVGGTLFSLGIFAVKTGTGLGYGQVSRKGIALTLGLYLLLFELIALLAVQLLKLLEPLLKGGP
WLHGVMALGMIVWGGWLIGKPGRRCSPASSLALLIPCPVCLTAMTFSTWTALHSLPLLPWAVGLVLGSSF
AVMTLLVMLLTKSGESGNNIPALGLAMITIGLYFIASLFLPAKVEQAKGMYGSFLKEMQPAAAGGNSSQS
LLLVILLAAALLAGFFMRKGDTK
>gi|189426718|ref|YP_001953894.1| TonB-dependent receptor [Geobacter lovleyi SZ]
MKRNRQKCAVVVGLALAACSTAQAETVPGEARLEQVVVTATRTEQDLATAPGSVSVVTKEEMEKRNITTV
DEAINTTPGVLSTRGKGMMDRMSAITLRGIPGQSRTLVMLDGITINSPYAGSVVSVGISPSSLERIEVVK
GPASSLYGGYAMGGVVNMITRMPEKRELTLTGGYGFALDSPNGMQNTRRVAASYGDKYLGKIKLYLHNDY
LATDGYRSDTNVQSSKPTAGITGWEPTTDYTGATRYRLGDKGKNGAWQDNLTAKAELELPSNTKLKLTFM
KSTGEYSYDNPATYLRNSSGAEVWSYGTVREASFLGGNGGSDQHLYGFSAETELATVKYKLNLGYLDQMT
SWGTTPTSAAPPNGGTRNGGPGKLSDTPAAAFNADIQASIPILDKHLLTVGGAYRTGWSHSREHNLSNWQ
DENSKGALTYESKGTDRTFALFAEGEIALLDKLTLFAGFRQDWWDTFDGYANQVGSVGYPQTYGSRSADA
FSPKGALVYRPFDTTTFKLSGGKAFRAPTVYDLYRTWTTSSGTTYAGNPNLKPETVISWDAGVSQRLWKG
SKFTATYFENYISDLIYSTSTTPTWKDKANAGKAESRGVELEAEQKFDSLLRLFANYTYTDATIKENSAV
PATVGKRVTDVPEHMFNLGADLDYGSFGATATGRYVGKRYSSDTNTDTVNGVQGSNDPYFTVDLKLRYKI
TAWATASLAVTNLFDEHYYSSSLAPGRSCYAELGFKF
>gi|189426719|ref|YP_001953895.1| O-methyltransferase family 2 [Geobacter lovleyi SZ]
MIPIVDDSFAGFSAMLAGYRQFYLLAEAVRSGIVDAVEAGSDTPAALADCLNLQPDETGRFVDLLCTLGL
LQQRDDRLGLSPFSQRFLSRASTENQRNTLLFEPLLIENWRQVGTILQQGQGALTQPQPQDAYHKRLELF
QASMAEAASVRSAELWHALAPLLPPQGIIMDIGAGEGAYLRAFLQRYPDWQGIACDLPDVCVRIMCQDLP
GKLTVLPCNILDQQEFSACTAAHHGTAGLVLLSNLLHCYGPQENGALLEQAAGMLTPDGLLVVHDFFRDA
NLYGALYDLHMLVNTWNGRCYSSIDTSALLQEVGLTHTRLIKLPSHSWAVLASRSQVALHRDEL
>gi|189426720|ref|YP_001953896.1| thiamine biosynthesis protein ThiC [Geobacter lovleyi SZ]
MQTQIEYARAGVITPQMQQVAATEGLAAELIRQRVAAGTIVIPWNHNRKPSRIAGIGQGLRTKVNASIGT
SSDIIDYAAEVRKALAAQESGADTLMELSVGGDLDRVRREVIAAVELPVGNVPLYQAFCDAARKYGDPNK
LDPEELFDLIEQQCADGMAFMAVHCGINRCTVERLQKQGYRYGGLVSKGGVSMVAWMLANNRENPLFEQF
DRVAAILKKYDTVLSLGNGLRAGAIHDSSDRAQIQELVFNCELAELGREMGCQMLVEGPGHVPLDEIEGN
IKLQKRMSGDAPYYMLGPIPTDVAPGFDHITSAIGAAQSARYGADLICYITPAEHLALPNEQDVREGVKA
AKIAAYIGDMNKYPERMRERDKAMAKARRDLDWQKQFELALFPEDAKAIRASRIPEDEATCTMCGNFCAS
RGAGKLFAEHLCGDKC
>gi|189426721|ref|YP_001953897.1| nicotinate-nucleotide/dimethylbenzimidazole phosphoribosyltransferase [Geobacter lovleyi SZ]
MHRITATLERIRPLDQQLLAQTQTRLDNKTKPLGSLGRLEEFACRLVAITGQEQPDLSRKAIFTFAADHG
VTEEGVSLYPREVTAQMVFNFLRGGAGVNVLARHAGAEVRVVDVGVDHDFENCPGLVHRKVARGTRNFCT
GPAMTTDETAAALLVGIDLAAQCKAEGIGLVGTGEMGIGNTTPSSAIIAAIGGFEVAQVTHRGTGIADQA
LANKIKVIERGLALHRPDPAKPLEVLAAVGGLEIAAIAGLVLGCAAERIPVIVDGFISTAGALIASELHP
QVRDYLFAAHQSVEVGHRFMLERTGLRPILDLDLRLGEGTGAALAMPLIEAGARILAEMATFEQAGVTGH
>gi|189426722|ref|YP_001953898.1| cobyric acid synthase CobQ [Geobacter lovleyi SZ]
MPDQLPHSEQYRHGGNLRALSRLSGRAPHELLDFSANINPLGPPDWLRPLIESRISELVHYPDPEASELV
AAISTQHRIPAAELLVGNGATELLHLLPRALGCSSLLLPVPSYSDYEAPARLQGLAVERFTLVPDNDFLL
DPQQLAPLLKPGQMVLLGQPNNPTGRTFAAAALRDLAASHPASLFVVDESFIGFTDASQSLQQDRPANLL
VVTSLTKLYAIPGLRLGYLTAAEAHIQKLRAFLPTWSVNSLAQAVGARAVQDQDYLQQTRSMVTQQRQQL
AQMLGQLPGLTIYPGEANFLLLRLDHSTLDAPQLAEQTLKQGIALRICANFQGLDQRYLRVAVRTETEQQ
QLCGVLHAILEPTRQRPARRQTPAIMFQGTGSNAGKSILTTALCRILKQDGHDVAPFKAQNMSLNAFVTP
QGGEMGRAQALQAQACRLEPDVRMNPVLLKPTSETGSQVILCGKVQGSTDFRSYAQQRQQVWSTVQGCYD
ELAAEHQVMVLEGAGSPAEVNLKTNDIVNMRMAQYAGAPVLLVGDIDRGGVFASFVGTMELLNEAERHQV
AGFVINRFRGDASLLGDALAYTRFHTSKPVLGTVPYLTNLGLPEEDSVTFKQGLLPCGAKDTQLLDIAVL
NLPHVANFTDLDPLGQEPDVGLRLVRSAAELGQPDAVLIPGSKNTLADLAWLQQTGLATAILELAQAGQV
EIIGICGGFQILGERIGDPLQIESTVGEQQGLGLLAISTVLAEQKTTRQTRCCHIPSGCMLSGYEIHHGI
TSADQLQPLMSSPDGSLLGAGDNSGLVWGSYLHGLFDADPFRRWWLDRLRQRKGWQVSGVVRACYNLEPA
LDRLADCVRDSLDMREVYRLLGI
>gi|189426723|ref|YP_001953899.1| hypothetical protein Glov_3680 [Geobacter lovleyi SZ]
MALTKIKLARILAANLKIHEKVALQHITDLMDLIKMQLIEGNEVAIVGFGILKPAYKLLFITASLEPFEP
VSVQRRKIISFTASLSIKKALNLLNAR
>gi|189426724|ref|YP_001953900.1| plasmid encoded RepA protein [Geobacter lovleyi SZ]
MTNDDHLVLPGFGGTISEEELMAKQALLKQKQAEEKARKQIAENISIGQLNLGLLPITNTSLPTPRQENH
HHETSETQQVISRKKKKMAEEIVSIMEHDASELGMISYMAQMLVQMTLPHSELRGTNGLPVTEYSKTNGR
ATLTIMTPSIYGGIPFGVVPRQLLMWLTTEAVRTKQKEIFLGDSLTAFMKDIGIAVTGGKEGSLTRFKKQ
SDRLFNSFINYDPGDATNAPRSNLKITSSNKSFSFWKTDGKPTWESHIVLDTEFYESLIQNPVPIDKRAI
RALSGNAFALDLYCWLTWRMYSVRKYTKIPWEYLQLQFGANYKDLRFFRRRFAEVLNQVLAVYPASVSVE
KDCLILQPSSTSIRKITPRT
>gi|189426725|ref|YP_001953901.1| hypothetical protein Glov_3682 [Geobacter lovleyi SZ]
MGRLKSTAISTSPEEDIVTFIVRLPLPLRKTIKMLAAREGITINDFFIRAAEKEVADVVANAKG
>gi|189426726|ref|YP_001953902.1| hypothetical protein Glov_3683 [Geobacter lovleyi SZ]
MRLKKRPTPEEEAAFIAGAKADQAELPAAAPQTLSTTPDSTETTLTPATTQATPAPEDVDPHQFVRRTEW
PILPSLDPYMADGREDLDKPFVMRMKENLWCSIDRHCKALGVDKSKWIRQAILNQMAAEQQHFINNNSKA
>gi|189426727|ref|YP_001953903.1| Cobyrinic acid ac-diamide synthase [Geobacter lovleyi SZ]
MVVLVANEKGGTGKTTVATNIAIMRAQQGRDVLLVDADPQGSSSEFIRVREDEQVKPTITCVAITGRGVS
SEVRKLIPRYQDIIIDAGGRDSAGLRSALIVADALIVPFLAGQYDVWGVENMDTIVGEALGLNPEMKPLL
VLNKQDTNPRISIAHEAEALAKEMQNLQILNTKLCYRVAYRRSAAEGRAVNELDKLDPKAVAELDALYKE
VFSDEA
>gi|189426728|ref|YP_001953904.1| histone family protein DNA-binding protein [Geobacter lovleyi SZ]
MALTKNKLIQLVAEQQHITLKDAALLVEELITLIKATLESGESLKIAKFGLFEVKEKHARRGRNPQTGEA
ITIEPRKVISFKPSVLLRQAINQ
>gi|189426729|ref|YP_001953905.1| conserved hypothetical protein [Geobacter lovleyi SZ]
MTPQQFIAKWKASTPKERSASQEHFIDLCRLISHPTPAEADSTGDHFTFERGASKTGGGEGWADVWKKGC
FAWEYKGKRKDLNAAFAQIQRYAIALENPPLLVVSDMETIVIHTNWTNTVQEIQTIAIEDLEKPEVRQKL
VWLFTEPERFRPGTTREMVTAQAAEAFASLAQRLHSQGYASRRVAHFVNKLLFSMFAEDIGILPGHLFTR
MLEACTKDPARFEKLASDLFGSMKSGGFFGVEEIPWFNGGLFDDADALPLDAEGLKLALAAARLDWSDIE
PSIFGTLFERGLDPAKRSQLGAHYTDRQSIMRIVQPVVVEPLLTDWQQAKIAMLPLLEKSRNAKTKKAQD
DNFRQAAEIYSSFLNRLKTLRVLDPACGSGNFLYLSLIALKDLEHQVTLEAESLGFHPEFLFHAGPWNVM
GIEINEYAAELARVTIWIGELQWMIKHGMAYNTKPILQTMDQIENRDALLNADGTEAHWPQAEVIVGNPP
FLGGSKMLGELGEEYVTTLRKVYKGRVPGGADLVTYWFEKARETGVRSGLVATNSIRGGSNREVLKRITE
TRQIFNAWSDEPWINEGAAVRVSLVCFDNGVGQGGLLLNGQPASEIYPDLTAASEVGSLDLTQAKPLLEN
GGISFKGSEKGGPFDVAGDLAKKWTSLPSNPNGRTNHDVVRPWANGMDVTRRPSDTWIIDFSGLTEEEAS
LYEAPFEYALKTIKPERLRNREVRTTEKWWLHRRSGEDLRKAISKLSRYIATPRVAKHRLFVWLDAAVLP
YSRLYVIASDSDVTFGILHSRIHELWSLATCSWHGVGNDPTYNAASCFETFPFPLNLQPETSQQIAAAAQ
RLVQLRDNWLNPVGASEAELNKRTLTNLYNQRPTWLDNAHKELDAAVATAYGWPADLPDDEILKRLLQLN
LERGSSIQ
>gi|189426730|ref|YP_001953906.1| transcriptional regulator, XRE family [Geobacter lovleyi SZ]
MLFTIGSNIREARRRRKITQEQMAKALGMSRTTISQIEKGIVQEVGVRKLIRILEYLGLELQVRPAGALP
TLEELQREG
>gi|189426731|ref|YP_001953907.1| HipA N-terminal domain protein [Geobacter lovleyi SZ]
MSVVSPHTLAVWAAEQRAGLLDRASVQRDYVFTYDLATANSSVAQVSLTMPLRLESWTSRDLHPIFQMNL
PEGALLEAIRRAISKVAGEDDLTMLRVTGGNQVGRNRFSLAADSAPGIVESPESLEELLSYPDTEELFHE
LVAKYALRSGVSGVQPKVMLDASERGTTAVGGYIVKTWGDDYPQLAANEFFCMTAAQRAGLLVPEFHLSA
NGRLFVMKRFDVGVGGSALGFEDMCALQGVGTAQKYRSTYERVARSIKDFVSGEFLQAAREQFFAALVLS
VMVRNGDAHLKNFGVLYDTPGAPVRLAPVYDVVTTTAYLPKDLPALSLVGTKKWWNRKLLEQFALAHLSL
PVKKVSETIEKMGEAVSETRNLLIAYIAEHPEYQTIGERQLAAWEAGTGEFVK
>gi|189426732|ref|YP_001953908.1| transcriptional regulator, XRE family [Geobacter lovleyi SZ]
MAEKRTISLYPASEKALRELGQRLKDARLRRRFSMDTVCTRADISRPTLYKIEKGEPSVVFAAYIQVLRV
LGLLDDLALIAKDDVLGRRLQDESMTRPKRAPKRTLHVSEGKGGDNG
>gi|189426733|ref|YP_001953909.1| HipA domain protein [Geobacter lovleyi SZ]
MAKLSSQDHLQVYLDDPAFGPLNNIGTLTRGDRGSIRFSYNRLWLDQAHAFPLDPELDLSAGEFYPQGSN
FGVFMDSCPDRWGSVLMQRREDVEAKLGGRSRRALGTWDYLIGVQDCTRMGALRFKRPQDEAFLASEDLS
APPVTRLAELQQIAFEITNKKLPDLGRLREWLRVLVAPGASLGGARPKANIIENDGSLWIAKFPARDDSE
DIGAYEKLIHDLARESGIDVPESRLVRVGDGYHTFMVKRFDRELDSRRFFSSAMPLLRRTDSEDASYLEL
AEFIANYGHIDHIEDDLEELFRRVVFNVVVGNRDDHLRNHGFIRIPAGWRLAPAFDINPSTSKDEHVLAL
DAYSRQPDLDVVISTADLYRLSPQKAKQIIQQVCDVVSGWRTKAKRMGLSAQDCLVLEQCLLVS
>gi|189426734|ref|YP_001953910.1| WGR domain protein [Geobacter lovleyi SZ]
MVTDKRFSDYGVCELAKIEPSLNQKRYYGISIQPGLFEIILHRQWGRLGCRPRSMDEYFNSIELAVAKAN
SLYGAKTRKGYREV
>gi|189426735|ref|YP_001953911.1| hypothetical protein Glov_3692 [Geobacter lovleyi SZ]
MQFFKGLVTGVIGLYLSTYIYKTATHPDATTLDFVAHSFNKAFPTIIVIIFVSLGLSFVIWSYFWFQNNS
KEIAEDEINRARERAEEIKCDAHTSVAEFRKDNEKTCFKLRMDAESLYAAAKEKYDAIVHKELDLEEHYA
KLVAKLESDFAAKRSAYIVEIDGLVKKNEKLQSDFSNMVGHYTDALKNNGLASIAGKYDKRANRTLDATH
YSTPGTENILRGNEPWADAPVQPV
>gi|189426736|ref|YP_001953912.1| conserved hypothetical protein [Geobacter lovleyi SZ]
MSITQKYIDNLSGITRQKRQSLFDWFSTQGETIKIEAIRLQGDLANQHRDRYDKQYRHEFYYAMLILALN
KMHWTETAHTQKKSLNDKESIQITQLRIERLKAQKRVKSAPKKELIRIRFYEEIAALKSQGLSWRQIADY
IRIHHKKNFTFGYLRNCFIELTAEKGGQN
>gi|189426737|ref|YP_001953913.1| hypothetical protein Glov_3694 [Geobacter lovleyi SZ]
MDPVKLREKAEKLLQKARNEERKQKEVLNRKVSAFVLSFIKNNGYNFDTIFADGIKAVIESSPICAEVLK
HDKP
>gi|189426738|ref|YP_001953914.1| conserved hypothetical protein [Geobacter lovleyi SZ]
MRGSVAYQVQSVYEYVSEIGTSKHEQKSVARSNGAKTWHQIGKHLGVMSYSTGDAYRDVWRQVLKFAKEQ
FGIKDIEKLSGSHLKAFLLKKIDGGVAHATHAQYAAACEKLEVALNRLAQINKTEHVYEFSASIKEARSE
ASSLKRFEGSRAYVNPDSLVQSVDSDIFQLAAAIQRESGARISEANHINKEQLRGIRRDIYSGKEKGWIH
VEGKGGKKREIAVSLTTYTRLQQILSNGRFEFDKDAYRNALEKAAELTGQSYEGSHGLRWSWAQERHAIL
QQHCLTYEQTLSRISQEMGHERGDITEHYLR
>gi|189426739|ref|YP_001953915.1| integrase domain protein SAM domain protein [Geobacter lovleyi SZ]
MAQNPKTPQIEDFEAGLPAVVHEILPVAADVPDLIDQAAEWFALDVANGDARPDTIATYISHLNHWLNWC
RVNNIDPGHATTTHLKAFRQELVQSGAAHATISLKLTTVRRFYDGAVSRGLLEANPVNGVKAPRKRTADA
EIIKCLTAGETERFFEAIPHDHKLKSLRDRAMAALMTLEGLRRIEICRANLEDIEETDSGVRILVHGKGK
DGYIYPREDTVACIQNYLIQRGPVQSDKDGEPIFVSLSKGDKVRGRITRIGLSKWIDTMLAKAGITKKGR
GCHALRHTCGALLYQATRDVKVVQETLRHASIAMAAKYSHVQERGKARYTQQIPVKP
>gi|189426740|ref|YP_001953916.1| hypothetical protein Glov_3697 [Geobacter lovleyi SZ]
MTGAEIQKLILNNEELTIIARHLHSNCYGVGVQHANGDYAGPVTLPENDQPLQFDSLDEVASFLSQIGVK
HFQVTI
>gi|189426741|ref|YP_001953917.1| transposase Tn3 family protein [Geobacter lovleyi SZ]
MKKVWDTDELATHWCLTFEDHHLLKNKLLKNHLGFSIQLKHFQYSGKFLHTHSDISTPPLEHVAEQLNVS
VSDFESYDFNSRTGRRHCIEILNYLGIQRLTSTDKDAFSDWLRQEIFHQGTTISEAIELAYDWFKKQKVE
YPTEAVLERLVRSAFYRYEQEFFNQIIRELRPSAKDKMDHCLENVERGIEFGRLKADPGRVGLESVLAEV
EKLHFIQSLDLPQGLFQTCNIKALTHYYQRVSSESAWRVKEHPPEIRYALLGVFLFFRQREIIDGLIELF
IQIVHRLTVKAERKLIKELLSDFRKVHGKSTLLFRIAEAALLNPEGRVKDVVYPVAGENVLQNLLKEFKS
SGPGYRQQVHKIIRSSYGNHYRRMVPKILEALSFCSGNTQHRPVLEALEWIQHNRDNSQRFIPLDEGIPI
DGVIRKQDQEVVLEEDAQGRERINRINYEICVLQALRDKLRCKEIWVMGADKFRNPDEDLPADFEDKRED
YYLDLGHSTDSSEFIEKIQERMRSALTELDEGIPRNQKVRLLNRGKKNISITPFEAQEEPPSLTALKREI
AGRWPMTSLLDVLKEADLRVGFTDHFKTVADREILDRQSLQRRLLLCLYGMGTNTGLKRVSGNRHGISYK
ELLHVRRRYVHKAALRNAIGQVANAIFSIRNADVWGEGSTSCASDSKKFGSWDQNLMTEWHIRYGGRGVM
IYWHVEKKSTCIYSQLKRCSSSEVAAMIEGVLRHCTDMTIDRQYVDSHGQSEVAFAFCHLLGFDLLPRLK
AIATQKLYRPDGDATEAFPNLERIMTRPINWELISQQYDEMVKYATALKQGTANPEAILRRFTRNNIQHP
TYRALSELGKAVKTIFLCRYLGSEALRQEINEGLNVVENWNSANSFIFYGKGGEVATNRLEDQELSVLAL
HLLQICLVYVNTLMIQQVLTEPAWHSRMKQEDYRALSPLIYNHINPYGIFELDMDLRLPIELVA
>gi|189426742|ref|YP_001953918.1| NADPH-dependent FMN reductase [Geobacter lovleyi SZ]
MKVLGVSGSPIRNSNTDRALKLALESTGLETEFIKLTDYTIEPCRACLGCRKTGQCVIKDDGFELTEKVK
ESDALIIAGYTPYSTLDSRTKAFIERLYPNRHGIAHMKGKPGGAIVTYCIPKSIPMFPASQNGVDAIKYY
MMEEEMDYVGDVQILGNMLGYLPTIKS
>gi|189426743|ref|YP_001953919.1| alkylhydroperoxidase (AhpD family core domain protein) [Geobacter lovleyi SZ]
MQTFQQIYQRAAKRKGGEETLRKMVPDNAEELTVVWQTINVEHNCTYCVPAHTGVAKMMKVDPALTEALR
NQEPMPTDKLQVLQNTTLAVVRKRGELSKDEVEAFYAAGYGQRQLLEIILGLSQKVISNYVNHIAETPID
RAFEKFAWEKK
>gi|189426744|ref|YP_001953920.1| hypothetical protein Glov_3702 [Geobacter lovleyi SZ]
MTDKELYSLFAFEAAVLLGQTGVPENSETASKVYSEAPWVTILDTARTEGFLGFAIKLEDRICAWFSRLI
EGSGKNSAYAIMGLTKHFAAG
>gi|189426745|ref|YP_001953921.1| conserved hypothetical protein; putative membrane protein [Geobacter lovleyi SZ]
MLVPGTVKFFEPFKTFFTTQIDRSGLPFSTLTFWSGQLGEITVGLTLLAFLFLWEKITPSWAKKIFYGGN
LAVTVIMLVALYVHLHPAVPAEVLPFEKKAPLLTVFTLLMVFLNVYLYRNAGRTILRGKEVLGKI
>gi|189426746|ref|YP_001953922.1| transcriptional regulator, TetR family [Geobacter lovleyi SZ]
MARAQFDREEIIDKSIGLFWENGYSASSMQKVVKTTGLKPGSIYLAFGNKEGLFREALESYARKTIEAIH
HLMATAPSISAGICMFLEQKVVESTQKTYCSCFLVKTRLELAAEGGELHELASSKLDKIEEVLEGYIDKE
YGSEVSKQRAISLMMHIFGVRVYGYQQGSADRMRLGLKEGLPWLPWETLN
>gi|189426747|ref|YP_001953923.1| hypothetical protein Glov_3705 [Geobacter lovleyi SZ]
MNSFALINQPPHFFSALLVIVSFLSAAFANQQSVKKFAHKVLYVGYALILISGCYLFATLPFSSFVLIKA
VGGVGLVVMAEMIVRGKGSTLIWTLLLVTASAGLGIAYFLI
>gi|189426748|ref|YP_001953924.1| Hypothetical protein MTH865 [Geobacter lovleyi SZ]
MNVKAEIKTQIAGALAGAEFPIASPEALLNAFPNGADTTCECGDVKLRAGDAGSVLTASDFPFESAESVA
DTIVSRAF
>gi|189426749|ref|YP_001953925.1| NADPH-dependent FMN reductase [Geobacter lovleyi SZ]
MKVLGISGSPRRGQTTDRLVQEVLGATECETEFIPLSGKRIGPCIGCLGCVKDNVCVIKDDMAELRQKIV
AADALVVGAPNYFDMIGGLGHCFLERFYQFRHRDGDEIAGKLGVVVSVGGRNPEAPARNIEKFFEYNQIQ
HLGTVTAQGPASCFKCGDGETCKVGAIKKLFGPNAKVTEDMIPDLSRQVGKIEEARFLGRNLGLRLKD
>gi|189426750|ref|YP_001953926.1| tautomerase [Geobacter lovleyi SZ]
MPHLQFEINRNLKDEEKISFHGEVQQLFAEVMDTGTDHICISIREYSTHNLFIGRVKDPAKGVAVVNADI
RQGRTMVQRRELTLGFMELMNKHWGVTKDQMYVTLTEHKGEDFHLLEKYLAGWEEGEDPLAD
>gi|189426751|ref|YP_001953927.1| Integrase catalytic region [Geobacter lovleyi SZ]
MTIRLHANATTTPRIRRYIQQSSKTDKGLAKELGISLDTVRRWRKRSEVHDHSHTPHRLPTTLNEAQEAV
VIELRRSLLLPLDDLLVVTREFIHPEASRSALDRLLRRHGVSRLADLIPKEDETQAKPKTFKSYEPGFVH
VDIKYLPQMPDETSRRYLFVAIDRASRWVYLELRKSKSAQAAKGFLERLVAKAPFKIHKMLTDNDKAFTD
RFSTAGERKPTGNHLFDKACLKHNIEHRLIPPRHPQTNGMVERFNGRISDVLATTRFDSAADLEATMLRY
AHLYNQHIPQRALGHKTPVEALKSWQKSKPDLFHKQVRNHPGPNI
>gi|189426752|ref|YP_001953928.1| hypothetical protein Glov_3710 [Geobacter lovleyi SZ]
MDLALQVWGGGFYLLNKIFFAVAEGQRENRQRKIWIAGWLVYILGVPAWFIILAGKHDWIAASIQAGVVP
SMLFGLYNAFSHTDSTNKTFDRIASLCTCICLAIGISYSLYDYGGLTAGSQVLELCIMLGFLVGSYLLAK
KNLYGWLFFMLMNGCMATLMLLQNKPLLSAQQLLSLCFVIYGFNVAWKFSRKQAC
>gi|189426753|ref|YP_001953929.1| DSBA oxidoreductase [Geobacter lovleyi SZ]
MSKTVDFYYDYGSPTAYMAWTQLTKICTKAGATLNYKPMLLGGVFKAIDNPSPMLVESKRAYLQKDFIRH
AEHYGIPYVMNPHFPVNTVGIMRGAMWAAATEHLEQYNKVMFEAMWVDQKNMADLEVITEVLEKAGFIAA
PIIEATAQAEIKKALIDATNEAVERGVFGAPTMFVGDEMFFGQDRLDWVERALND
>gi|189426754|ref|YP_001953930.1| short-chain dehydrogenase/reductase SDR [Geobacter lovleyi SZ]
MTKTKGPKVALIVGAGDHLGSAIAKRFAKEGFAIVATRRRGDLTGLIDEIEALGSRAYGLHSDARNEAQV
AELVEKVESDIGPIEVAVFNVGGNVRFGILETTARVYQKSWEMCAFAGFLIGREVARRMVPRKSGTILFT
GASASLRGVSGFAAFAGGKHALRALAQSMARELGPQGIHIGHVVVDGLIENRSTEELFPDLVASKSEDGI
IQPDHLAEIYWHLYQQPRTAWTFEIDARPYSEPW
>gi|189426755|ref|YP_001953931.1| transposase IS3/IS911 family protein [Geobacter lovleyi SZ]
MGKQQRYTPEFRSEAVKLVLEQNLSLSVASKRLGIPEGTLASWMAAVRSSSKPSAPGSRSTPDLLAENAR
LRKELAETRMERDILKKATAYFARESLPGTRS
>gi|189426756|ref|YP_001953932.1| Integrase catalytic region [Geobacter lovleyi SZ]
MKKWRLHYPTVTMSRMFNVSRSGFYAWLKRNPSRRTQEDERLKVAIKVAHTRTRESYSAKRLQPELAADG
FIVGRDRIARLRRELGLRCRQKRKFKATTNSNHNLPVAENLLDQTFTPSAPNEVWVTDITYIPTGEGWLY
LAGVKDVFTREIVGYAMSKRMTQELTGRALFRAVQQKRPAAGLIHHSDRGSQYCAHDYRKLLKQFKMKTS
MSRKGNCYDNAPMESFWGSLKNELVHHCRYETRDEAKASIQEYIEIFYNRQRRHSRLGYVAPAIFAQNYN
NQQQVA
>gi|189426757|ref|YP_001953933.1| IstB domain protein ATP-binding protein [Geobacter lovleyi SZ]
MLNQPTIEKLTVMKLSGMAKAFADQMQRPDMASLSFEERFGLIVDFQMTELENRRMQNRLRTAKLRFSAS
IEDLDLRQGRGMDRALILSLAQNQWVRQHHNILVTGPTGAGKSYLACALAQKACRDGHTVLYQRLPRLLH
DIAVARLDGRYHKLMAPIGKCEVLVLDDLLISPLTTEEQRELLEIVEERYDRKATIVTSQLPIKAWYDAM
QDPTLADAILDRLVHNAYKIELKGESMRRKRSTLDRKSEAVTE
>gi|189426758|ref|YP_001953934.1| Integrase catalytic region [Geobacter lovleyi SZ]
MPRERVAMRKIREILRLVWGCNRSRRDTAKACGVGKSTVNDTIARAIAAGLCWPIALDDEALEKLLYPPP
QPPSSRKLHQPDWQSLHDELTSHKHLTLMLLWQEYKEGEPSGYQYSQFCELYRQWRKKLDRSMRQEHRAG
DKFFVDYSGMTLPIVDASTGEIREAEIFVGVMGNSNLTYAEATWTQGLPDWIGSHIRAFGYLGAVPQCVV
PDNLRSGVTKACRYEPQLNPSYAECADHYGTAVIPARVRRPKDKAKVEGGVLIAQRFILAGLRQRTFFSL
AEANAAIRQRLELLNNRPFRKLPGCRRSRFEEFDRPAMRPLPETPYQLSQWSKARVHIDYHVEVDHHFYS
VPHRLVGEQLEIRATATTIECLHRGNRVASHPRSYLQGKHSTLPEHMPKAHREYAEWTPQRIVAWAAQSG
AATAAVVEQILSRKAYPEHGFRSCMGVISLGKRFSKERLEAACARALAIRGVSYKSIKSILENNLDQKPL
PSQLELPPVSHENLRGTHYYNDERLSHAEPTDH
>gi|189426759|ref|YP_001953935.1| transcriptional regulator, LysR family [Geobacter lovleyi SZ]
MELHQLKQFVAAAESESFTRGAERAFVSQPALSASISKLEDEMGTQLFIRNKRSVVLTPAGRKLLKRAKL
IIAECAQAKAELKHHEVQRSLRLGVINTLAIGQVAKLIEQYRRENPEVLLDVTDASQDQIEKLQKEARID
FALTRLVQGKEKKGRQEVLFSEPYVVALPLGHHLSGRKEVSFSELAEEPFIARTHCESRALIGELLKEKG
VRLNVVYKTNQDDRAISLVEVGVGIAIIPQHYASTSIAKISLADLKAERQIGFEWTGESNKEEIEKFVDF
SKTVPWAH
>gi|189426760|ref|YP_001953936.1| cob(I)alamin adenosyltransferase [Geobacter lovleyi SZ]
MALLPELLPDELEMTKPDKQANEQTAKHNKAMKKHKEKIDGCIVRAEEKRGVSILLTGNGKGKSSSAFGM
AMRSLGYGFKVGIVQFIKGKQQSGEEIFIREKHPEVYFWQMGTGFTWDTQDRNGDIAAAKTTWAHAQELL
QDASYHLVILDELTYMLNYEYLDEEMVLSALRNRPEEQSVVVTGRGGGEALRDLVDTVSEVQDIKHAFKS
EVKARRGIDF
>gi|189426761|ref|YP_001953937.1| thiamine pyrophosphate protein domain protein TPP-binding [Geobacter lovleyi SZ]
MSEYTKKDFVSSQTVKWCAGCGDFAVLSAVQSVLADIGRPPHEYTFVSGIGCSSRFPYYMNTYGYHTIHG
RALPVATGEKVANPKQSVWVVTGDGDGMSIGGNHFVHTARKNPDLVVVLLDNRIYGLTKGQLSPTSEFGK
KTKSTPWGSVEEPVEPIALAAGSGATFIARSTDRNMDLTKQMLRAAYEHKGFSLVHIMQNCVIFNDGANS
EYRDKTTQEENNIFLEHGKPMIFGKDKEKCIILEGFAPKIAPVAEVDPSQIMIHDAKSKSPAVATLLSSF
IDEGLPNPLGIIRQVEAPVYDQLVETQIDEVKAMVGEGDINQLLAGGDTWAVQ
>gi|189426762|ref|YP_001953938.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain protein [Geobacter lovleyi SZ]
MTSEERETMSQTELSRVVIKFTGDSGDGMQLTGNQYTLASAAFGNDVATLPDYPSEIRAPAGTISGVSGF
QMQFGDGKVNSPGDFPDVLVAMNPAALKVNGKFVKPGGIILTDIDAYTESNLTKAGYTEDPFAAPELDGK
KVLKVPMTSQVVAALEAFDAPRKAKEKCKNFFTLGVLFWMYDLAPEHNIAWMKEKWKSKPQLVEMNETAI
KAGMIYAENSTGMAQHRYRIKPAELPAGTYRNLTGNDATAIALVTASKLAGVDMFLGTYPITPATDILHE
YAKYKQFGVKSHQAEDEIAGICSAIGAAHAGVLAATTTSGPGMALNAEAMGLAAISEIPLVIVNVQRGGP
STGLPTKTEQADLMQAMYCRNGEAPIPIIAAKSPSDCFHQTLEAVRIATKYMTPVILLTDGYIGQGSEPF
RVPSLDELPQIDVKFRTEAESEYLPYARDEKTLAREWVKPGTPGLQNRIGGLEKDFLTGAVSHDPVNHQK
MVDVRAAKVDGIADDIPELEIYGDQDGGDVLIVGWGSTYGSIKNSVDKYRAQGKSVSQAHFTHIYPFPKN
TEEVLKKFRHVVVTEINAGQLNELLRAKFEVHTEQINKVQGLPFREHEIAEVIDTLI
>gi|189426763|ref|YP_001953939.1| Methionine synthase vitamin-B12 independent [Geobacter lovleyi SZ]
MKNPSGRTKQASVGIPTEPVGSIPRPPELQDAMLAHAQGEMTSKELDILFDKAVSETINEFEATGSPVVS
DGEQTKSSFATYPLDGLDNLATDGIIISFADGHTRQLPRLTKGPFRYAAYAGSYLARAREFATRPVKQAV
ISASAMSLLYPEEGLPDYPREQFLADLIKEAVADIRSCFDNGAYQVQIDFTEGRLAVKLDPSRQLLQQFI
DLNNQVLSYFTEEERQRIGFHTCPGGDHDSTHSADVDYGELLPLLLTLSASNFYVQMASEEDPEKYLQII
ADNLRPNQRIYVGVIDVTSEEIESVETVRDRVFLAAKYIPLAQLGTTDDCGFSPFSDDVATSRATAFAKI
TARIQGTQLAYAQLK
>gi|189426764|ref|YP_001953940.1| hypothetical protein Glov_3722 [Geobacter lovleyi SZ]
MNSTNDKMEWTTWPEAFDLLFQGVTLQTCIPVAIVVGLILSTINQSDVIISGAATSLTWVKVGMNFVVPF
CVSSYGFLNARRTEAPALELENTLES
>gi|189426765|ref|YP_001953941.1| ribosome small subunit-dependent GTPase A [Geobacter lovleyi SZ]
MNLDDWGWSPFFAEQSMLQQKGYLPARIIRGEKNFFRVLCAEGELTVRFTGRMRHGAGTRADLPVVGDWV
MVQPQPDGRGMIHAILERKSSFARNLPGRRKIKGRERAEQQVIAANVDLVLVVSGLDRDFNLRRIERYLT
LVGGSGAEAVVVLNKADLCENPQRCLAQVKEIAPKSPVYSCEARDPRQLEFLLPHLQPGRTLALLGSSGV
GKSTILNGLLGEQRQKIGEVSQADGKGRHTTTHRELFQLPQGGILIDNPGMRELHLWGDEEDLVESFSDI
EELSGKCKFSDCRHQVEPGCAVLRAVEIGEITHERLGNYHKLKAELTSLQRRR
>gi|189426766|ref|YP_001953942.1| NADPH-dependent FMN reductase [Geobacter lovleyi SZ]
MKVIGISGSPVKNSNTDRLVQAILKSTGLETEFIKLSQKRVQPCIACMACVKDNVCKVKDDFPEIGEKVR
QAGAIVVGGYPPYGTIDGFTKAFLERLFSLRHRDGLNRGKLAVTVVTGIGRGVPGLDQGSEQLGLALSME
GMEVLGQLKVTGTTECLICGYGESCPMSSLPWVFGEDIEVTPDKFCKVEEQVEIWQQGQNLGKEIAERLA
TGG
>gi|189426767|ref|YP_001953943.1| transcriptional regulator, Crp/Fnr family [Geobacter lovleyi SZ]
MMSESSCLCEQIAGPGAELHPKCFGHVWLFEGAPPEAWDTISADLARKKCAAEDVIFSQGEPAESMYLIK
MGSVKIWKVDEEGRELTLDIRKAGDLLGESVLIEESDYPVYASALTPTLICGVDRSTFEKLVEAHPQVGL
AVIRNLSKRIDYLTGKLGALSEPSIEERLYKVLVNVAEQVGTPESGGWSIAFPLTHEEIGFLVGAHRVSI
TRALKKLKDLGKVKSQGKYIFVARAAA
>gi|189426768|ref|YP_001953944.1| haloacid dehalogenase, type II [Geobacter lovleyi SZ]
MAITLAFDVYGTLINTHGVLTALEGLVGDRAKAFSNTWRDKQLEYSFRKGLMQNYETFAVCTSQALDYTC
AFYGVDFSDGQKKELMGIYRVLPAFADAKEGLAQLKETGFRLFAFSNGAADALEVLLSNAGIRELFFGVV
SVDDIKTFKPSPAVYSHFLRQSESIGGTAWLISSNPFDVIGSISAGMKAAWVQRSPEAIFDPWGIEPNIT
VTSLIELKEQITNYEGTE
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
>gi|83582731|ref|YP_425037.1| putative partition protein [Rhodospirillum rubrum ATCC 11170]
MILTVGNTKGGVGKTTLAVNLAVERFLAGKDVLLIDADNQRTSSAFSALRESLHGQTGYTCIELSGSAVH
QQGRNLAPKYDEVIIDVGGRDTSALRGALAISDIALVPFAVGTFDIWAAEDIGRLIEEARGFNPTLRAFS
VLNMADPAGGDNADAAGLLTETSALVYLRASLVRRKAMRNAAAAGLGVLEMTGSSRDSKACGEVGYLAEL
LYNKLN
>gi|83582732|ref|YP_425038.1| hypothetical protein Rru_B0002 [Rhodospirillum rubrum ATCC 11170]
MAIARKPQTPPSLPKDLDAWVGEAGSDTPIGEPVRPKADHMVSLRLPRDLLERLDQNRMARLDKPTRGAW
IKAAIAEKLDRV
>gi|83582733|ref|YP_425039.1| glycosyl transferase, group 1 [Rhodospirillum rubrum ATCC 11170]
MIRILLLTKYDETGASSRQRCFLFLSELRKRGFVIDVQSFFNSDYLPRLYKGYRPDAKAIVRSYAHRLLA
MRRAGDYDLIWLEKEFLPWIPHLLEWGAFARTPYVVDFDDAWFLRYQNHPLALVRWLLGRKFNGTIRKAA
CVIAGNATLETWALSLGARRVVQIPTVVDTTRYKISPVTQAPFTIGWVGTPVTAAYLALVHDALRQLCAQ
GGVRLRVIGVPGFRLEGVDVEALPWSEETEADLLSDIHVGIMPLPDGPWERGKCGYKLIQYMAAGRPVVA
SPVGANVDIVSPGKTGFLATTTEEWVRALDCLKNDLGQREQMGLLAREEVEESYSLESQIKKLSDILKDS
PMRS
>gi|83582734|ref|YP_425040.1| hypothetical protein Rru_B0004 [Rhodospirillum rubrum ATCC 11170]
MPPILSLDQWIMLAKAINPDAPEAKRALVKLMRHHGVTLDPREEESPPIYTDFSALPLPPAELSDERGED
LLSYASPLSELRWEMVTTREELTLAVKNVGLDLNAVRPTLEGMDEEAMLIQPSPFCLQAQDFLGVLAVLL
RRRVPLRIYRVRRSAFEAPAIVLMRLFPEPSAETFAILDQFHPDAAPKIRDLSRRISEALHFIENGENI
>gi|83582735|ref|YP_425041.1| glycosyl transferase [Rhodospirillum rubrum ATCC 11170]
MQSPPLVSVVMPVYNHERYVGEAIDSVFSQTYRPIELIIIDDGSTDKSAETVRQHLAAKPAPEGIIVDFV
SRPNKGAHTTINEGLAKSSGSYLAILNSDDAYMPKRLARCIATAQEHEARMIFTYVEPIGDDGVDLDVGH
PWRHWYADVMLNELDISPNISSLLLQYNIGVSTGNFLFHRSLFEEVGPFHDFRYTHDIDFLLRASLIEEP
VLVRERLYRYRLHGHNTISENDRKISEEYQEIVLRYFRETLIKRPANIFAPSFDNWVFSMVGSPWLPHMA
RAIEQLLKTPEAALSAPTETKQPVLPGLDGRHVTLVSHELSYTGAPVLLRDVALALRREGVSSNVISLSS
GPLAKEFIEAGCQVTTEGRLPAFLSRLSRVSERFSHNGRFPAVFRKLFGKMSWLSGGISHRLRLRDYVKT
IKGPVLINSFASWPIALGLLEKRQGPAFWYIHETYDPRMLMRGLAHYRRLRALVDGGAVTLLFGSEATRS
VWAEAGFDGLVRYWSGLDPMPKSTLPTKKAKRVVLSVQASGTRKGTRVLLEAFAFARREGLIGDDVELRI
IGCHAPSWNYLSRDLIRRICEPDLIGAVRLIGSLEPAMLEAHYQEADVYVQSSIMECLPLALLTAMAHSL
PIVCSDADGCREAILDERTGRLVPPRQVKKMGYALADLLGDRAKANKLGMAAGAHFAENFALRVTVPKLL
DTLFTERS
>gi|83582736|ref|YP_425042.1| NAD-dependent epimerase/dehydratase [Rhodospirillum rubrum ATCC 11170]
MTQYLILGGCGFIGRHVALALARRGESVVVADVAAPPAELANVPVTFRQVVPGQTDWQALTEDCDVIHHY
AWSTIPQTANDDPIRDLDDNVRTTLGLLDVLRHQGKKRLIFASSGGTVYGRLKRIPAEEHHSLAPITAYG
ASKACVELYLGFYRAHHGMDCRVARISNPFGAGQDARRKQQGAASAFLFKALAGEEITIWGDGSVIRDYI
HIADLTRGLIALSDASLADHHDLPIYNLGSGVGISLNEIVETLRNRLGLTATVNYLPSRNFDIPASILDI
RKSKDLLEWSPQMSFAEGYSLMFDDLRKNKKYFSTLPIS
>gi|83582737|ref|YP_425043.1| glycosyl transferase, group 1 [Rhodospirillum rubrum ATCC 11170]
MFHRASAFMTDITPIAPAISSASDPVWRQAGLETLVPRRLVQPDSWAGHIPFAFWVIAQHRPRQCVELGV
HTGNSYCAFAQAVEHLGLETKCVGVDHWFGDPQAGYYGEDVYADLKAHHDPLYGHFSRLLRMSFEDGRAY
VADGSVDLLHIDGLHTYEAVREDFETWHSKMSERGIVLFHDTDVRTDDFGVWRFWAEIAERFPSFEFDHS
NGLGVAYVGTRPIEAPGLAELFAAGSDPQARDLPRRYFARMGEGWINRVRLDLATEQWNATTNALNHLQA
RIDEIERDRLGLRREREILLQRLIKVDQWDALALQCRDGLDIDLDALAEAIGGLYNADQPQAIEARATLH
RVLRHLIEEGTCGSVPGDVSRRLMRLSKKAGARVVAPFKAPAKKQERPLDFLRESGFFDESFYALSSEAL
AEGRDPLEHYLTVGEAMGVAPSRSFEPEYYARRHPDVLASGMGLLRHYARFGAQEGRQGLSPARRLALPD
LSAATREKVVLLLQDASGSDVSLYGLFLARALQDLHEVIVFLKEDGPLRSAFKESGITLIDMPSETELFR
CDINAVAKRLVEALQPAYVIANSAETRSFVPPIVQAGFGVVALVQDFAFSVYPKNEIYEIFAWAHHLVFP
ARAIMESFVEDHPFLGQRRYEILPQGIPALPELDARLPSKQGSALRPAGHEDDFVVVGIGPLRFEKGADL
FVSVATAALQERPDANLRFVWIDQTPSFDEQAEFSKYLQEQILRAGLSEHFSVLGALDGTDVYEQADLLA
LTSRLDPMPRVYVEALTQGKPVACFEHASGLAEVLAGNEETRSLVVPYLDTTAMAKAILAFYDDPVRQES
LVPTLRDKARETFCMASYLSRVEALGQQASREAKGISHDYEKISASGLFKASFLTPSVSEETTEETLKGY
LVRNRIGASKSQSDNWIDLRRPVIGFNPLVYAENISGLNGHKDPLADWIERGSPKGNWTHPVIDLETSLP
SPIEGGKVLLHGHFYYVDLIDDFLKKIIINDFSCDLIITTTDEDRAVFLRKKLEEYKNGSVEVRVVPNIG
RDVGAFFTGLSDLKNSDYDVVGHIHGKKSIHLSDGTGNKWRNFLWEHLIGGEKKAAAIAVSALIRNPDIG
LVFAEEPFLFGWDKNKELANDLAKKMGIEKSLPRFFDWPIGTMFWAKRKALEPIFDLNLRWEDYPPEPIP
VYGTMLHALERLLPFAVEKAGFSFATTYLPSNSDNIFRTPIDKVGS
>gi|83582738|ref|YP_425044.1| putative fragment of transposase protein, partial [Rhodospirillum rubrum ATCC 11170]
MTNDIMSLRGLLEKSADADLLREMIGFAAERLMALEVESLTGVGHGERNPDQRLVHRNGYRERDWETRAG
TVELRIPRLRKGR
>gi|83582739|ref|YP_425045.1| transposase [Rhodospirillum rubrum ATCC 11170]
MAEKALTAVIQEAYIQGISTRSVDDLVKAMGMSGISKSQVSRLCAEIDGKVATFLDRPLEGDWPYIWLDA
TYVKVRQDGRIVSVAVIIAVGANTAGRREVLGMTIGPSEAETFWTEFLRTLARRGLRGVKLVVSDAHEGI
KAAVSKVLCATWQRCRVHFMRNVLAHAGKSGRRVVSAFIGTAFAQDTAQAASAQWRQVADQLRPRSRKLA
ELMDDAETDVLAYMTFPPAHRTKLHSTNPIERLNGEIKRRTDVVGIFPNEAAITRLIGAILLEQNDEWAV
QRSRYMTLESVAPLGDDALTRLPPIAAA
>gi|83582740|ref|YP_425046.1| resolvase [Rhodospirillum rubrum ATCC 11170]
MLIGYARVSTQDQNLELQRESLSKAGCQKVFEDKVSGTRADRPGLAKALEMLREDDTLVVWKLDRLGRSV
KQLVDLVGDLHKQGIQFRSLTDSIDTGTPSGRFFFHVMASLAEMERELTVERTRAGLEVAKQLGRKGGRK
PKMTDSKIASAKKLLASGVPPKDVAKNLGVSIPTLYRWVPASSHA
>gi|83582741|ref|YP_425047.1| hypothetical protein Rru_B0011 [Rhodospirillum rubrum ATCC 11170]
MEGLAKDDFLDDKRTQQAVIMSLIIGKAATKVMDGYAEFTKAHANVPWRNMRNMRNRMAHGYFDINLNVV
WEMAQEWLPALLKQLPASASECRLGWNHD
>gi|83582742|ref|YP_425048.1| DNA polymerase, beta-like region [Rhodospirillum rubrum ATCC 11170]
MKRSAGREAVGRFRTANPRVFGSVLHGTDRDDSDLDLLVDALAGTTLLDLGDLEDELKSLLGVDVNLLTP
GDLPPKFRAKVLAETQLV
>gi|83582743|ref|YP_425049.1| hypothetical protein Rru_B0013 [Rhodospirillum rubrum ATCC 11170]
MSRRLILSTAERIREAGVGLRGLAEPWADTTTPAGGMVSTVFAGIAEFERSLIIERDRVPWIGVTAPSPF
DLRQAWPG
>gi|83582744|ref|YP_425050.1| transposase [Rhodospirillum rubrum ATCC 11170]
MAEKALTAVIQEAYIQGISTRSVDDLVKAMGMSGISKSQVSRLCAEIDGKVATFLDRPLEGDWPYIWLDA
TYVKVRQDGRIVSVAVIIAVGANTAGRREVLGMTIGPSEAETFWTEFLRTLARRGLRGVKLVVSDAHEGI
KAAVSKVLCATWQRCRVHFMRNVLAHAGKSGRRVVSAFIGTAFAQDTAQAASAQWRQVADQLRPRSRKLA
ELMDDAETDVLAYMTFPPAHRTKLHSTNPIERLNGEIKRRTDVVGIFPNEAAITRLIGAILLEQNDEWAV
QRSRYMTLESVAPLGDDALTRLPPIAAA
>gi|83582745|ref|YP_425051.1| putative fragment of transposase protein, partial [Rhodospirillum rubrum ATCC 11170]
MTNDIMSLRGLLEKSADADLLREMIGFAAERLMALEVESLTGVGHGERNPDQRLVHRNGYRERDWETRAG
TVELRIPRLRKGR
>gi|83582746|ref|YP_425052.1| Phage integrase [Rhodospirillum rubrum ATCC 11170]
MNPPPKVPNADRRSREYLTLAEIDRLIAAAQHLGRHDQRDATMILLAYRHGLRVSELVELRREQVDLRQG
LLHVRRRKNGLPSTHPLRGPELRALNKLLREYPENAYVFVSERGAPMTAATFRKLLARAGDAAKLGMPIH
PHMLRHSTGFKLANDGQDTRAIQLYLWHKIYRIQPITRSSRRTVSMPSGWIDGWMSLPGNRDLHAIR
>gi|83582747|ref|YP_425053.1| LysR family transcriptional regulator [Rhodospirillum rubrum ATCC 11170]
MKPPPRQFPDLNLLVTLDALLSEGSVAGAADRMNLSPPAMSRQLARIRHLMGDPVLVRAGRGLVPTPRAE
ALRGQLRQLIQEAEALVRGGGDFDPARIDHSFTIRANDGFVGTFGAAITRMAVEQAPKVRLRFAPEGNED
VESLRDGRVDLDIGVIDAMGPEIRLQALFHDRFIGVVRPDHPLARETVSVEAFVAYPHVSVSRRGRFEGP
VDAALALRGKRRTVPVAVASVADGFSIAAQSDYIVLVPARVTAWHRQGLHSFDLPVTTDALPISAAWHPR
FEKDAAHRWLRTCVRAACAAI
>gi|83582748|ref|YP_425054.1| hypothetical protein Rru_B0018 [Rhodospirillum rubrum ATCC 11170]
MHSSPLPSQAAGLPGFGRLAVYLAGCVVFAVGAYLFIYSRLGTDPLDVFSLGLLRHVPLTIGIAQTLVAV
ICLGAVALWTHQRPLLSPIFTFFFCGSLIDMLRLLQPADLLGMVPMPAMLLGTLLCAYGSSLIIMSGFGI
RGMDLLAIEMTGHWGLPFWFTKGALEVLLLASGWLMGGPVGIGTITFLLGVNGLIQPMMWANARLLHLRN
FGLPPREALQESLAI
>gi|83582749|ref|YP_425055.1| O-methyltransferase family protein [Rhodospirillum rubrum ATCC 11170]
MTSAVRNSLLDPKVSAVIERVWALQAEINPVGEAVVRADMARRTTPFTHREIVAACAAGSFACPPEIGRT
LYALVRAIRPKVVLEFGTAHGFSTLHIAAALRDNGEGHLYGSEMHPAKVQAARTNLAEAGLADWVEVLEG
DASETLGTVPDVDLLYLDGWTDHYLDVLQAVERNLRPGALIQADDVGKFGAGSGAKAYLAYVRDQANGYS
SVTFTDYQGFEQSCFAGRP
>gi|83582750|ref|YP_425056.1| major facilitator transporter [Rhodospirillum rubrum ATCC 11170]
MSGVSTPRIPAADAPFASPDTPARRQAILAVMVGCAALVFGLGASLNLAVGRIATSPLHPSATAVLWIVD
TYLVVFGCLLIPAGAIGDRYGRKQAMLAGLTFLAVGSLLSAVAATVPVLLAGRAVAGAGAALILPNSLAL
VVQVYPADQKSHAIAVWTGMTGLGGALGNILGGLVLQFAEWQAIFTVAVPLALAGLALTAWLAPRQAGHE
HPLDLVGAGILMLSIFALLTGLIEGQELGWASTEVIGALCAAAALLAVFLTTAARRKHPLVDPRIFRARG
LCAGMLGITASFIAMYSLFYLNGQYLMSVKGYPPALAGICTLPLVVVLFWLSPRSVQLARRFGARPVVAV
GLAMLIVGLGLLRLCGADTSYWFYAASIGVIGIGSALSNPVLSTAIIGALPPHQAGVGSGINSFTREIGG
ALGVALFGSLLGSSFPSRLPDTLAQAHGAVQRSVGAALAYAESLPGTAANQTVQVVRQAFSGAMAQSLLT
VMLVLAVAAVLAVLWYPASAGSAEK
>gi|83582751|ref|YP_425057.1| DNA-binding protein Fis [Rhodospirillum rubrum ATCC 11170]
MGGRPFKMTAAKVRLAMAAMGKPETKVNELCRELGITRQTLYRHVGPDGALRKDGRKLLERRNG
>gi|83582752|ref|YP_425058.1| resolvase-like protein [Rhodospirillum rubrum ATCC 11170]
MLLGYMRVSKADGSQLLDLQRDALLGAGLDPRHLYEDLGSGRRDDRPGLVTCLKALRSGETLVVWKLDRL
GRDLRHLINTVHDLTGRGVGLSVLTGHGGAIDTTTASGKLVFGIFAALAEFERELIAERTRAC
>gi|83582753|ref|YP_425059.1| hypothetical protein Rru_B0023 [Rhodospirillum rubrum ATCC 11170]