Commit 6b722927 authored by Raquel Bromberg's avatar Raquel Bromberg
Browse files

REFS and Examples added

parent ecf11784
>gi|154147865|ref|YP_001405618.1| hypothetical protein CHAB381_A0001 [Campylobacter hominis ATCC BAA-381]
MIYYPQNSILKKPQSFAELRGKYCQKGANMRKHTKHLLLKLYLNFRLFKLKVEVEIRK
>gi|154147864|ref|YP_001405619.1| putative RepE [Campylobacter hominis ATCC BAA-381]
MRLGSRQERGRKSPPFGSIKQSKGDKMAKLPVYYDNKMNLLAFKNLDKVEANLFFSIVARFNDKGAEKLK
LNFSEIAEFISDNKYTSKELSKLINDGVGKVVQSAIKWEMTPIKTAYFTLFNEFLVDDENKTLEASINSR
FLFMLNNFKDGNFTMLELAEFSSLKSKYTQTLYRLLKQFRFTGFRSIKWAEFIEIMDIPTSYRARDIDKQ
ILKPAIAELTQEADIFNQNNPIFKKLIYKKIRGTGRGRPVELIEFYFMPETDEPKEQKKNEKALQYIAQD
IKKEQMLKELKRSSQEPKKINPLTGQEITGLEPYRLRNMRFKNKFGEYDILKIQNIEQEPSGKIIVTVRN
VDDNHISTMKFDSLKHFENTFNLHQM
>gi|154147862|ref|YP_001405620.1| hypothetical protein CHAB381_A0003 [Campylobacter hominis ATCC BAA-381]
MRVLLSKRSVRQRVTSPYDLNFSIIFAFLERFPFNIFLNLTFNLLDPFLASAWWWFAWVFRG
>gi|154147861|ref|YP_001405621.1| hypothetical protein CHAB381_A0004 [Campylobacter hominis ATCC BAA-381]
MKSYKSIRKTIRFTDDEFSTIKEKMELGNYSNFTEFALHSMINKKPSKAKSINKEYLLELNRIGNNLNQL
TRKLNKGDRLNNLSLSAIIDIRDSINSLKEKI
>gi|154147863|ref|YP_001405622.1| mobilization protein [Campylobacter hominis ATCC BAA-381]
MIVKFFNTKKGGGNSAIDYLLDKRVEQGTSRILQGDEQLTRDIIKNMSQKHKTCVGVLSFEEKDIDEQLK
FKLMADFEKALMTDEAQGRYNILWVEHNDKGRLELNFVIPKIDLQTKKALNPYYHNADLSRIASWQDIKN
IEYNFKNPKDPSKEQTIQGSKKQVEIYKDYEKLDNFLQQEVKNGTLQSRAEIIKLLQDNGVEVTRQGKDY
LSIKLPDNTKAKRFKGGIYSDEFRSIESIRTIGDEQKEREREFSQRDNTAELERLRNQFERAYNAKSKYY
KREFEKRDRQHKNRYDNYRTGIDEFKANEHKADNFIDNSISSDFFSPISETSRSDIDDSVRNRIDERARQ
LREREQEAIRTAKRTRADYKPTQKEPIRLNEREYALLADNRKQQQEPIIDENYIREREKRKREAIKRIRE
LREARERQRNTELEASIKPSFERLREVREGIKQQHERHTIFADIFRQSEASFRKHITGRIQEFGRQFQRN
ITEFGETLREQGKRSIKSGIDEVRAFINKHKRELERVLEKGKTKA
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
>gi|299883391|ref|YP_003738944.1| transposase IS4 family protein [Halalkalicoccus jeotgali B3]
MVAAALVADATGYNGRSRFFEDDPDGTGDALDGFVADVTTIAQSQCERAGSYTDIETLVCHLPIDHLTFA
AQDSLAPYSGRYPMAIHVRATLLMEINGWDETALHDHLRTHPSLRQNLGFETLPNQSTFWRAWNERFSEK
LRDAVRECADSIVRAARACGVSLPDRIDIDEADESDADDPPERQLVAAKTDEVWQQAKPFVTDAFALSRG
PNWQIHENAFWEQHAYMGMREDMYARSGPASFSLDTTRERIPTGSTHRYQIGKLSVAEIRSMLRNTTRML
IARARQNGELDGPVFAAIDVTKGFPFTGDLEDHDDDILGYKDGNDYYQWAVLKIVGMDVPLVLDAIPRVR
GQSKDEIVEKLLSQTTEMVDIDLVMMDREFDSGPVKDTCEEYGVHFLNPTRIFERSDEAETIAWMYRNGK
RFHVTEEETLEGTSTRKQIYLPQRSNSDDDEDDSLSEVWTEMCGEWEFENVDGEPSEGMSFSRLLADIQR
EEEVEERKQKAKDGDVDTAETVVFETNHPYVTARGTDDQRMEGKEFIHMIERLIRWYRRRWGIENGFKKQ
KHFMVRTTSTERDYRFFNFAFACVLYNVWRLVDLLVKIAIDGEDLTYKPRVDANQFLTVAKQYYGLDPPD
>gi|299883392|ref|YP_003738945.1| Resolvase domain protein [Halalkalicoccus jeotgali B3]
MQIAAYVRVSTDDQNEDRQMRAIRQKYSETETSNEIEWFCDLGESGASTSRREYQRLREHVAEYDVVVAH
ELDRLGRSFADLAGFVEDLREKGVGIDLVNQPIGTVGEDDWMAEMMLNMMMVFADAERKMIRSRVQEGID
AAIADGKRVGRPPFGYTVEDGFLQQIPAEYVRTQTFIREVRKGREKHATAGFFEIPESAVQSILARAEAN
YDVPFDNDQWRLERAKVSAGEKDLPPLDAQSRYSPALTSVPEQ
>gi|299883393|ref|YP_003738946.1| putative transcriptional regulator, AsnC family protein [Halalkalicoccus jeotgali B3]
MSSSTDHFYAVFAPLANDRRMCLTRHSIHIAMTGIDDVDYEIIELLMENARHSYREIAKQVDRSPPTVSD
RVERLQEIGVIERFTLDIDRSILVEGPSVLVELDVEPNSDETVANTLADTPAVEHIIRTLDATVLFVAHG
SEQDIRALLSETLDGAQIRSYTVRLVSESTWKPQLGAESVSMECTVCGKSVDDGETVELGEQTHEVCCTS
CASKIKTQYDELKEAAASE
>gi|299883394|ref|YP_003738947.1| hypothetical protein HacjB3_19093 [Halalkalicoccus jeotgali B3]
MAVQQIGLSDEMEECVDTCIEAAEVCEWCADECAGHGEGMAECLRLCRDVADLASLCARLCVRDSEFNSQ
VAEACAEACEACAEECEQHDHDHCQACAEILPRCAESCRNMA
>gi|299883395|ref|YP_003738948.1| hypothetical protein HacjB3_19098 [Halalkalicoccus jeotgali B3]
MDGAYLPNVSIGSSLSFADCTLRNACLTNATLRNADCSRADLSRANCTGCDFSDSVLDATCLDRATLDGA
DLSHVSGAEVTLVGATLVGADLSHARFEDADLSDAD
>gi|299883396|ref|YP_003738949.1| hypothetical protein HacjB3_19103 [Halalkalicoccus jeotgali B3]
MLRETTLTDATLKETLLVDADLTEADLEYAAMIRTDLRGADLTGAHFYGSVHDNCRIDH
>gi|299883397|ref|YP_003738950.1| Ion transport 2 domain protein [Halalkalicoccus jeotgali B3]
MIPEDESLGAVVADGNVDLLDKAIWTYGALQTISRENKLNQQASEYYVRQHDTQRRQVWARGQYLRWAKA
EGARWVMQYGEGIWNVVYTALVVIVLSAVLYPLSAVGGLRRSSSGAALTYATGGPLDPSTVTGIRNLVAI
LAESLYFSVVTFTTLGYGDWVPLGYAKGLAMAESLIGTFIASLLIYVLARRVMW
>gi|299883398|ref|YP_003738951.1| hypothetical protein HacjB3_19113 [Halalkalicoccus jeotgali B3]
MGVFVVFGQAIDAVSTAVGVDILAVSEQVPLSRAVLNLAATLPTASIIGVGWLFVVLKLSLATGLVWVVA
TDSETTPLGTRLLFLAAGLAGFLPGVRNLVLYALA
>gi|299883399|ref|YP_003738952.1| Methyltransferase type 11 [Halalkalicoccus jeotgali B3]
MSERGRSIYDWWSRHERLFNRLYDVAFLGRETELRERAVKSLALDSGERVLELGCGLGNSFEALRTRVGS
QGAVVGVDYSHGMVERAAERVRQAGWRNVHLVHGDSGRLGADDGAFDAVYAAMTLSAMPNPADAVDTAYR
ALRPGGRIVVLDAQPFQEFPWTILNPVIVPLSKYTTNWFPEENIPTALASRFGSTTVATFNGGTIFIATA
RKPKQNDEI
>gi|299883400|ref|YP_003738953.1| copper-translocating P-type ATPase [Halalkalicoccus jeotgali B3]
MSEHSIRDETERGNEPATTDTPPTHRPGDSGDDIAQTDHSGHEEMFRRRFWISLALSIPVIVFSEFIQDI
FNYTAPVFPGSEWITPILSVVVFAYGGVPFLSMARTELENREPGMMMLISLAITVAFVYSLASLVLPGTT
PFFWELVTLIDIMLLGHWMEMRSVRQASGALDELAKLMPDTAERVTEGGDTEEVPIDELTEDDVVLVRPG
ASVPADGEVIEGESSVDESMITGESRPVDKDPGSEVVAGTVNQDGSLRVRVTTTGEETTLAGIMRLVDEA
QQSKSRTQLLADQAAGWLFYVALGVAALTLVGWVIATGFDIMVLERVVTVLVIACPHALGLAVPLVVAIN
TSTAAQNGMLIRDRIAMEESRNLDTVMFDKTGTLTKGEQGVVGVETAEDWDEARAFGVAAAVEGDSEHMI
ARAIRNAADERDVDRPQVSEFENLRGLGVRATVDGTTVHLGGPNLLRKFDIERSESITSFAEEAGANAQT
VIYLVREETDVVAAFALADVIREESHQTIRALHDMDIEVAMITGDSEDVAAAVSEELDIDQYFAEVLPEE
KDQMVTQLQEEGKLVAMVGDGVNDAPALTRADVGIAIGSGTDVAIESGDIILVENNPLDVMRLVRLSKAS
YRKMQENLVWATGYNVFALPLAAGVLAPIGILLSPAVGAVFMSLSTIIVAINARRLRGVDLS
>gi|299883401|ref|YP_003738954.1| multicopper oxidase type 3 [Halalkalicoccus jeotgali B3]
MASAPASAEPSPEAATSQSPTVPKNADQQRTLTATTGPISPNGTERSNPAWLYDGQTPGPELRVAEGDVL
QVSLENQLPDPTTIHWHGIPLANPMDGVPNVTQAPVEPDGTFTYTFEAVPAGTYFYHSHIGLQLDRHLIG
PLIVEEESPHVAFDRDIVVIFNDYLRGAPQPESEWAVQGGGGMGGGMGGGMGRNQMDGGMNMASRPDYAG
LLANGRLPSNPSEFTIEKGEWLRVRFINASGATTFRVGLGGHRLNITHADGQPVEPVTTDSFAFGPGERY
DAVVEANNPGAWAIEARSVDGDEQPATATLRYEGATGTPRKPSFDGNQLGYGDLHAVESIEGLQGSPDRT
FDVTLSAGRGPGTWLINGQRFPDADPFAVKAGEHVRIRLNNRSPVAHPMHLHGHFFHVGDVLKDTVMVPG
HMGRVTIDFLADNPGEWLFHCHNIYHLDGGMGRIIEYTG
>gi|299883402|ref|YP_003738955.1| hypothetical protein HacjB3_19133 [Halalkalicoccus jeotgali B3]
MANSTRTDLATILLVGLAILVLAPMLMMGFAMPMMGGMYGYGAGGNAGLVGLLVPLVVLLVVLGAGYLLV
RRVAGHTDSRDTALEELRSAYARGDLSDEEFETRREKLESD
>gi|299883403|ref|YP_003738956.1| hypothetical protein HacjB3_19138 [Halalkalicoccus jeotgali B3]
MTYTLTTTADESLDEAVAATTDALEDEGFGVLSDIDVRETLKQKLDVDTRQYRILGACNPQLAHEGLDEE
PELGALLPCNVIVYESDDSVTVSAVDPGQLVGITDNPALDSIAEEVYERFERVLETVGEEA
>gi|299883404|ref|YP_003738957.1| Heavy metal transport/detoxification protein [Halalkalicoccus jeotgali B3]
MSCEHCEQTVEEALQGISGVSDVRADHEAENATIEGDPDSDAIVRAVEDTGYEASV
>gi|299883405|ref|YP_003738958.1| transcription regulator [Halalkalicoccus jeotgali B3]
MRDLDETDLEILDLLLSDARQPWSEIAEVVDLSPPAVSERVKRLQEIGIIRRFTVDVDRSQLYEGVPILL
KLTVKSERFESVRAELLEAEAVEYVFTTAEHDLLCYALVVDGDVPTWLAEILDVRSIKDYDVQLLTGVKW
TPTLRETKFALTCAECGNTVTREGTAARIGDELHQFCCSSCEARFEEQYERMEEEATG
>gi|299883406|ref|YP_003738959.1| copper-transporting ATPase [Halalkalicoccus jeotgali B3]
MSCANCSQTITQALTDLDGVSEANINFATDEGTVEYDPEATSLAAIYTAIDDAGYSALSTSASIGITDMT
CANCAETNEEALEDVPGVISAEVNYATDEANVEYNPAETDCEQLYDAIESAGYSPVRDDGSGDSEQDQRD
AARNEEIRHQLRLTLFGAALSLPMLAFLIEKFILGGGALPETIFGIEFGWVEFLLATPVQAVLGWPFYKN
SYKALVKNRSANMDVLIALGSTTAYLYSVVVLLGLLAGGLYFDTAALILVFITLGNYLEARSKGQASEAL
QQLLEMEADTATVVDEDGNEEEVPLDEVDVGDWMKIRPGEQIPTDGVVVDGQSAVDESMVTGESVPVEKE
EGDEVVGSTINENGVLTVEATKVGADTALQQIVQTVKEAQSRQPDIQNLADRISSYFVPIVIANALLWGL
VWYLFPEALAGFVGALPLWGLVAGGPAVAGGTVSIFEFAVVVFASAVLIACPCALGLATPAATMVGTSIG
AQTGVLFKGGDILERAKDVDTVVFDKTGTLTEGEMELTDVVPLDSTRTATDGGDAETAADGGTQAIRGEA
EPGAETEINEETVLHAAASAEAGSEHPLAQAIVEGAEERGIDLTDPENFENVPGHGVRATVDGEEVLVGN
RKLMRDNDIDPSAAEDELERLEGEGKTAMLVASNDTLLGLVADADTVKESAKEAVAALHERDLAVHMITG
DNERTARAVAEEVGIDPDNVRAEVLPEDKSDALDAIQQDGRRAMMVGDGVNDAPALATAYVGTAIGSGTD
VAIEAADVTLMRDDPLDVVKAIRISDGTLQKIKQNLFWALGYNTAMIPLASLGLLQPVLAAAAMAFSSVS
VLSNSLLFRRYTPDHDYKLLGFLR
>gi|299883407|ref|YP_003738960.1| hypothetical protein HacjB3_19158 [Halalkalicoccus jeotgali B3]
MLVLPMLDIGLFQDPLFVQSSYELRMKLFPGHHPFA
>gi|299883408|ref|YP_003738961.1| hypothetical protein HacjB3_19163 [Halalkalicoccus jeotgali B3]
MSTTNTLETEILNRSVRFDYSERWIGYSLFLLRIMMGWTLFQGGITKLITYLDDDPANNWTAAGFLTGAV
PEGNPLMGAWVDMAGSPLIDLLNMWGLTLTGLALILGAFVRWSAFWGAVMMLFYWAASLEGGLLAGLPLA
NGWVVDDHLVYAVLLFGLGAFGAGRILGLDSYLEQLSVVESNPWLRYLLG
>gi|299883409|ref|YP_003738962.1| putative metal ion permease [Halalkalicoccus jeotgali B3]
MPTTLVDGVLESLRIGVGFLWVAAWAIIMGLVITSLVQVYVSKERMAKVLGEGDLSGLTKATLFGAASSG
CSFGAVAIGKGLFKKGAHVVNFLAFMFASTNLIVELGLMILLLLGWEFLVAELLGGIILIAVMALLVHLT
LPENLFEDVRAELTQRDREQGVTEDPTCGMEGKDEYSLVTDGGQTVKFCSAGCMETYEQEMASSGGWRDE
LLSWGGWYKIGNQYRKEWSMIWTDVIAGFLISGFVIVFIPQWVWNALFLQGDGLLVSAENAIMGVAIAVI
SFVGSMGNVPFAVALWGGGVSFAGVIAFVYADLITIPVLNVYRKYYGWKVMTYILGVFFVTMAFSGFLME
ELFDVLGIVPNLAGGQTATEQTYFELNYTFYLNLIAFALSGFLFYVYRRGLGAPGQYRDPVCGMRTDEDG
PTVTHDDETYHFCSESCKRVFTNDPDGYSDVHPIASPTGGQAHDHD
>gi|299883410|ref|YP_003738963.1| hypothetical protein HacjB3_19173 [Halalkalicoccus jeotgali B3]
MNTVIERLLHAFGYALAYGLFFRAETPETVVRRLRLAYRLVGVRIEQTASINGMERTVFRCPYRSLLAGR
YGEKWVCHEKLDRVDDGYVTYLKRHKGIDYNRPRSCEQLTGCEDSTCCFSEVSEPEVKENGP
>gi|299883411|ref|YP_003738964.1| sterol 24-C-methyltransferase [Halalkalicoccus jeotgali B3]
MGRDDGQTRIADQFSSLGERAAIWKAFALFLPTNQFLNVGYSEWYQPHFVGLSQRRLAERIGSDIAARLG
STDGVSLLDIGCGRGGPTLHLATEHGFVTTGIDLVPCNVSMARRNAAATVDAQFVVGDALQLPFERDSFN
VCTAIDSPPYLPNKREFLTEMASVTVEDGLVAVSDFVRPESLSQEARDTVDTFADAWDLAPIATLEQYKR
AIAVSGLHLDAAVDISPNSIARFQKWTGLYLSLARRGLLKPVERFLDRRNIDCDAITEQVSTTHPALPLL
RHVIIYARA
>gi|299883412|ref|YP_003738965.1| hypothetical protein HacjB3_19183 [Halalkalicoccus jeotgali B3]
MFSLFGGSDEVEARQISEALSTDLYDRARGDLPILGIRPYRGDDGLERGERLLKSLHDAEWSGRFRTKNT
SPTHAFELLYTDSDEILQFRFAPGTEDAKRQMLRQLQTYYPDSDIQELTPHFMDAPAGKYIAGARLELME
ENFYYPIKHYKIEQNEFAQDPYDSITSEMVGSPELADTDVLVQMVLRPAISSHPKDSKNWFSGIPDTLKE
MGEQKASLRKGAILEQMASTFTEGGDDDIQHTTTVDLDNDDVYQVVKSQYGSKAYHLNFRIIAVSDDPEV
AEQRVMNTAGMYRKFYNSKNRQGFRTVPMTGEGLDEFLRSAAGREFADRNILMPIDTATGACHVPTDLNT
QQADYSMTTAGKGVPPRTPRFDFDSVGLDRATSPLEDKQRALLSDDEPANPIWYGWGTKNGVEAGVDPEI
LNVHQFVGGSTGMGKTTLLINYFRQIMQRGHGGLFFDPKGDDAEDVVSLIPEGREDDLLYLDIGADSEYE
IGFNFLEVPLKNPELGTASTEAAIEALADDLEALLAQSGSGGGWHARMSGITRSVVRGLAQWQIETERDV
TMLDMYYALLDEDGRQEYADMMASERIEWIEDYAQRVLADIEQDSVEPLIRRLKEWVESGTTRRIVSHPS
STISIEEAVREGKIIVVRNRSSSDTAKRLIATALIRRIWIAIREQSNADDEPDPPKFYTVIDEFDKIVSK
ESEIHNILREARAFGLSLTLACQNLETGNDDKIGLPDGVQRAIQGNCKTFLTFDPGDPADAREIAPQHSP
DIEPEHLTELSKYHLYMRTHDDRDEKTDSYKVKALAPALDALPLRGEDETDELIAHSQEKHGQKARTSAE
IKADTLLYPGEDDGTNESDEDDDTPALVRAMALQAVYDAGYYDGDEDGFVSLSDASDRIARYVERVSDDV
PDTPSKIEGLLGPLPESILERDHRGELHVRCTDEGKARFLSPVDEDNKVNENTGGMAHAELMRDAYDNLL
AVGLPLHVVRQGGDDDPDALAEPESTKLRLARENPTLEPAEVASLVEKFREENGLLDRLSGAGTVDVEAE
HSTGDTAPGVTLEHIARSVENGRRCLMLARPDTAESIARRLDEYPECMRAYSGNEGVSRLYNANGDVRAG
PNDVRVYRPAGGQSVWLYHEDTETVELRDSDDETLATFTDPEDVFADPTDYPATEKDISDFSEWSTVKRP
ALPGRIDRDMVDVIAVTDDGLEVLEPSGDRTPIGQLLDGDDDTESDDTEESPLAKFR
>gi|299883413|ref|YP_003738966.1| transfer complex protein [Halalkalicoccus jeotgali B3]
MSKTDDTPTEQTDTETPSIDADLQAAIKPGRIDRLVNGSPLEGILSHSPITEWFEPERGTIIQDFAAVQR
AFKHEHAVELDGGHGVVGAIKVDPASMAMYEKDDLLLPINAFAGVLSTLPPHQRGMMVDIPRSVDYTDHQ
QSAKGHERRLRATIRSGTVDQPPTREIDPSVDKTEREAIQAVLEMEAGDEPDTWPLEVQADIAKERATIE
SFYENTTAKREHYIVLEANELDAARTLSGINGGLADLDFIGKPVKERRVRRLRENSDLTGIMVRELNRRL
KSLQNGLEKLQGISARRLTSAEFTEVIADAYRPDDVTQIKHFTDMVRQSPVPGSEDAGDPNHNVSHPGND
VDFCEGISDVTDEDDLMHQYRTLVMPETFDPETDGSITLDGDTLSATLQVTGWPDVPPTAFLEPLYQYHR
PGVDVKIATHFERQANPKRTAKNQEHSMEDRLEGQFGTFFEDYVQRKYDEASSFAESIDDTNFAVFSASL
SVTIEASTRHWDEQTGEVNHSDHRLTDAIEDIEMILKRECGLDTARMDDRHDEGWQSSIPVCNNELGENV
TLRADALARQWAYQYKNREDADGTMIGLHDYLREPTRVDVGDLENGHSMGIYGTIGSGKTTSLQHLVNSF
KQHHDERDIPFKMILSTPLQDLKSLCDIYGGEWIRVGKDAAVNPLNVPYVPPEKYRNIKKGSPWHGFLNR
FDTFLYAYYDMMDLANIGEKRDTWTLAAKEAQRRQGIERGDPESYRNPSATIPDVIEVLEDIVLDPDEFV
RERLANEEGTLEKRQGVARDIITHDIEAFEPDGRFSHFCERSDLDLMDHDVIYLDHQDQEQDQRAGGLEM
MMRLSDLHEQQKAFEGHTAMCVDEFHYMLSNPRSAGFFKRLHRHARHWGEWIMLATQEIGDLFETSTKDD
GSTEVSLSESAEVIYNNQAMQLYHHTKEMNPTWADILDLTPRSQQYIRNADMGKKSDGYSQALFVVDEDQ
YPLRIEMSDDINPRQFAVYQHDPTDHPDTRMYLANYTDDQGRDPCNWGWT
>gi|299883414|ref|YP_003738967.1| hypothetical protein HacjB3_19193 [Halalkalicoccus jeotgali B3]
MASDSGSYDPRDTGEQLTMENVSLMPNWLGFNAVWAMVLVVVCVLLLVPSVVLFNIAPWQVALVVLVATL
VFDALVLVTALLASIVTPSHESTLQYLRSRYAEWHGRETIRSDPTLPSRRDR
>gi|299883415|ref|YP_003738968.1| hypothetical protein HacjB3_19198 [Halalkalicoccus jeotgali B3]
MNRRRILVLTVTVALLASSVGAVGVLAQAGAPGIDNATNSTNATPSDAPTAPGVGGNNTTSGNSTGTGGP
IGIAQGVLNTGANIATGGAQAAANMALGPIFTFILDIPTIDIGLTDPGGIHTPTSSPYDILFPVLYVGIA
VPITTVAFGIITFASFGAAPFASLRAFPWSTHGTLSRGVRAFVAILGGIVFHLVGFSIVHELFAGFTEHV
AASPAQMIENMGLLDFSLATAFVGMGLYEMGWDILKWAGLLYAIIWIYIAFFPMISMPFTAAWLYSPTST
FGKFSGYLHVTHLALLISKAAVAVQLFAASQLDWGLSFDGIVAAFVSLGLIASALATPPLMLIFMWLSKG
RLIAAVGAGAGAAAGSSAVAAKVREKAPDTERVKEQGKGYVKRKGAAAQGKWWDVKNRAQFLGSAASGSA
AGVAYSGKERFNRWRSDDPGVGSSSKTSADGGVSPTRSERMRRFEEMNDRAGGLTTTQRKRYFNLKMEEK
GAFDSGLGTDGSEGSDGK
>gi|299883416|ref|YP_003738969.1| hypothetical protein HacjB3_19203 [Halalkalicoccus jeotgali B3]
MQVLQVKEVADSAAKRLKSRAAARARPLLIQSIPVLWGALLLVSPAFAQQSGQETGVQLCQSAPYNFFVG
LGWMVIGFSTLAIGTAIFSGGAAKAFGFVSGRVSSAGNGMLVGGLAAFGLIALVLVAAGIAFGTMPVTPP
TECVVFF
>gi|299883417|ref|YP_003738970.1| hypothetical protein HacjB3_19208 [Halalkalicoccus jeotgali B3]
MKSYTTPDIPEAMWVHWRRLTPHEQSLPPRSRRLYAADVACAQKHGQGIIETAIEEGLIDEQDIQDAFDI
EYPDDYNSDSE
>gi|299883418|ref|YP_003738971.1| hypothetical protein HacjB3_19213 [Halalkalicoccus jeotgali B3]
MSNPIDTAERKGANILAYAVAMVGVFAVLNGGFLPGGLFLAGAFVLMPRFPLFGELPQFVGWILIAIAFT
TLPS
>gi|299883419|ref|YP_003738972.1| hypothetical protein HacjB3_19218 [Halalkalicoccus jeotgali B3]
MATEITTPTDASPSLSLSRRAFLASATVGITGGLAGCTDDAGSSGRGGISSSKRAAGGVGAGFAYQTPAI
TRKQATHIARTPDQFDAALDAATPDNLVIVWIPADAAIDYTGRSRRVSNAVIASSRSTSHAGGLLYSNDM
GGTSSAYRGGEVDGVLKLGENSRMTGVRYRGPTSATWNHPLYPGYIPFGSGNAARREEYRSQRHSRGLSI
TAGSVRVDNCEIFGWSTQGISVNCPRSYGREREQSYPGIQNCSIHDCGLSGYGYGVEVNVGHPIIQRCFF
NGCRHMIAGEGYPDCSYSVEGSFFGPAGSLFPLDMHNLAENIGGTTNPDDYRYRYRSGGLIRVLNCTVAF
SHVINIAASSSLSAGGNPFAGNQTSAIGIGGLPAQGVVVQGCRFVHDGPGSAFTVGLLPRHAETDQYGLA
RWETKNNQFGLRADFPVGQP
>gi|299883420|ref|YP_003738973.1| hypothetical protein HacjB3_19223 [Halalkalicoccus jeotgali B3]
MAVTGVTTWLFTRDTEGDEKGAQSNAESDGNETGGSIDENGTAPEASRVDVENESQPAAADPEPEPEGPE
TNESAINESAPDTTPTAEDVTLSDTELVIESNMATVTGTATNEGDEPVTIDLEVQFLEGDEQLGRPALGG
TTGLQPGDSWEFTISARGSELSGATDYEIAKNVQTRS
>gi|299883421|ref|YP_003738974.1| hypothetical protein HacjB3_19228 [Halalkalicoccus jeotgali B3]
MFRHGELKSREVGELTQFSRGSKNHQLGVLLDRELIEIIGWDEDAGRDGERILGLTDTGRDLVEQHLTEK
GERPDEYRLRVERLEDDVDELETENEQLKDELESLRQDHEELYEKHRGLVDTLENELF
>gi|299883422|ref|YP_003738975.1| hypothetical protein HacjB3_19233 [Halalkalicoccus jeotgali B3]
MTYLTDLDWLVPAKEWERYCNLMQEKWGDIALYGGIIASQAMRQYMDIDEFAEVEKEISDTLQTGGPSEI
EKTNATTTPLSEQEKCRVRVGVHPPTKEAFSSFARSNGENPGVMFAYAIREYREGGRLGRIAEKLEQQDD
YEQEQEQERNPTTPAEKHEVICDRIRGTVGLDRNISEETLIEAIEDVAGSSQPTIDKYLPDVLDDLELVY
HPDDADLYIHESRLEEVGARVGLDIDPHSPPIDRKPAAVLDRDERIQGIKIALHRNARAMSVSEIQSSVL
DGAWSWDHADELATEIANQDGFGFRDTKSKKKILGKSGGSSRQTRSQSSSQSSEIDSTGSDHAQQDDHDQ
EGQDDNDERETITSDAAAEMDALMNAEVATDGGEDI
>gi|299883423|ref|YP_003738976.1| hypothetical protein HacjB3_19238 [Halalkalicoccus jeotgali B3]
MGANQVTMVKDGRERDPDSGRYATKYEETDYIETIRDLDGAAGTQEIVDALDANYDTVYSALRRFEDNEN
SPITSRKVANARLWQLKE
>gi|299883424|ref|YP_003738977.1| hypothetical protein HacjB3_19243 [Halalkalicoccus jeotgali B3]
MNTNTTPTKEGIDKRTIRAATESMSIDRHAGEAGEVDVYSESGSVYRVCLITETCECPSDTYQDGACKHQ
RRVEMALGQHDVPNLDEETDVELMIAAREQYRGLGDSTVEHRPADDAVVVTDGGVATESPMQDTDVNEPT
ITGPWTEPAEQGGAEYWRCEDCGRESLRRGDVERSEFHAEECVLR
>gi|299883425|ref|YP_003738978.1| heavy metal translocating P-type ATPase [Halalkalicoccus jeotgali B3]
MTENPRTAAGVSGDAQRRELSVRLSVPEMDCPSCAQKVDKSLQRVDGIVDANLQPTTGTATVTYDSDRVT
EADVAAAIENAGYEVVGGSNDETSGSNGGVNVAPPSDIWTSSRAIKTWIGAGFLTLGLLFEFVLTGQDVT
VASVLDYPLHLADIVFLVAIVSSGLPVVRGGYYSAKNRSLDIDLLMGTAIIAATGIGYFVEAATLAVLFS
IAELLEDYAMDKARNSLRELMELSPDEASVKRGDDEVTVPVDEVEVGETVVVRPGDKIPLDGTVVEGESA
VDESPITGESVPVDKGVDDEVYAGSINEEGYLEFEATSPASESTLSQIIEMVQGAQEKKTEKEQFVDRFS
GYYTPTVVVLAILTATLPPLLISGGATVSLAGFSHTFSGSWQTWFIRGLTLLVIACPCAFVISTPVSVVS
GITSAAKNGVLIKGGNYLEAMGDVDVIALDKTGTLTKGELAVTDVVPLGDANDKKVIQHAAALEQRSEHP
IAEAILARADEMKLDDVPSIEAFESITGKGIRANIDSETYYAGKPALFEELGFDLSHAHLRTDGGAVAET
AHEQCEQEGCTDIDNGAISRFEDEGKTVVLVGTDTELVGIIGVADEVRPAAEQAVARLHDLGVHVVMLTG
DNEGTARAIAEQIGVDDYRAELLPDEKVDAVETLQAEYGDVAMVGDGINDAPALATAEVGVAMGAAGTDT
ALETADIALMGDDIGKLPYLYALSHKANSVIRQNIWSSLGVKALLALGVPLGLVSVALAVVVGDMGMSLG
VTGNAMRLSRIEPE
>gi|299883426|ref|YP_003738979.1| transcription regulator [Halalkalicoccus jeotgali B3]
MRELVFALEYKPGCNRVADALADHPNARIRSLSLHATSENLWRVDHVTGDSDALADIENAFLTSDYYADC
LATEDCGATQSTKVLDRTDNTLVLYSYWERTPDCASVPHIARDHLGDGVLFETRHEGRHYTWRLIHSDEG
DVAAFFDDLETAVGECAQMEMLRTTETTASKGSTSRNASDLSPEQEAALRAAVDHGYYESPREVDVGELA
KHLDMPRSTLTYRLRRAEEHLAKQHVANKSVPEEPPASL
>gi|299883427|ref|YP_003738980.1| hypothetical protein HacjB3_19258 [Halalkalicoccus jeotgali B3]
MPDDPDDDVRVWLVERTYSDDEQNLIILIYATPDGERYFRKERALTSFTGPARETTAAVTVDPGNLGSVD
TADQREQYATEAQRMAKIHDPDDPI
>gi|299883428|ref|YP_003738981.1| hypothetical protein HacjB3_19263 [Halalkalicoccus jeotgali B3]
MVADIITSIGSPAIGGIIAAVAGWQVTKWDREKNREAKKKQWYMSLFRLSQELNTSPTTALFMELGTDQQ
RLIQQFEQIASQLDQERYRAPADIEPGLIAALVDTATNANRLRLDRNDFRTKLDHHKMLMFAEELHYYIQ
SELGDDTPIKFDQERMDRIEDQIATREEMDPTEWRAKVASEMADKWAEDSEASEGMERTLGQR
>gi|299883429|ref|YP_003738982.1| hypothetical protein HacjB3_19268 [Halalkalicoccus jeotgali B3]
MNIRSLSGLVLIDCPSESRGFAQPAMTATADATDSSTVEALAQTVEELQETVNEQAERIEQQAEKIEQLE
TEIDVQSSNVGGCHSRVSDLTERVDDLEDSHTQPDPMGTTAGDGGGTDAQNGQTPLERICGLPEHIVDRE
LTANQKRARFLAKDVRDYAEKVPAGLFMDSQTITKVIAAAEGKKPHTQTVARVMDFLDDLGKDDIKVKKR
QGKKFVVVDPEAADRYHSRCDRGDGKTPSERVIGTV
>gi|299883430|ref|YP_003738983.1| hypothetical protein HacjB3_19273, partial [Halalkalicoccus jeotgali B3]
MELVREIATTEPESVRELARRVDRDVGRVSRDLDTLYKAEVIEYEQKGRAKQPVLAHENIFVWPVVYDGS
VLEENVQK
>gi|299883431|ref|YP_003738984.1| hypothetical protein HacjB3_19278 [Halalkalicoccus jeotgali B3]
MDSITIRLQEDRLRRIADEADQRDMSRSDVIREWFDERDELRSECARLQSECEDLQTECDRLQREKRLLL
EQREEHTELVNAVKEERTLAKQKANAGVFTRAKWWLVGMGDDD
>gi|299883433|ref|YP_003738985.1| putative restriction/modification enzyme [Halalkalicoccus jeotgali B3]
METALSYRTNRGLFSNYYLDEHLPETEEWDEISEAELREAYEEISELWNREKELAPDRNESQLEQKFIRP
MFQRLGIPFEVEETVEQGQRRPDYGFFESDKAAENAFKRRNEGGDFYEYAIAVADAKRWGRKLDTRGKKK
RDYENPSHQIDQYLRKTSTRWGVLTNGQKWRLYYRPTSHKLDSYYEIDLPTILEKGDLEDFKYFYLFFHH
EAFLEDASGDSFLDDVFHESNVFAQELGEDLQDNIYDAIKVLSEGFLQYPENDLNEDDLDLIHDSSLIYL
YRLIFVLYAESEGRDLLNTDNEFYEQFYSLNSLKQEIAEEFDSGNSKYRNWQDNLWSQLKELFELIDQGS
KSHDIPPADLYIPAYNGGLFRTHPDTGDSREARFLATYKVGDAYLARVIELLTRSQDSNGGGKIFVDYSS
LDVRHLGSIYEGLLEYQLNVADEPLALSDGEYVIPDEGGNIVVEEGEIYLTTDSGERKATGSYYTPEYVV
EYIVENTLGPLIDDIYEDLLARDPFDKEGGGQFAQDFAERVFNLKILDPAMGSGHFLTNSVNYLARQIIE
AQQRQDEQMDEKTTDEHRDINWARRKVAQRCIYGVDLNPLATELAKVSLWLRTLAAEQPLAFLDHHLKTG
NSLVGSDIENVLANSNDEPIDGQLTLEQSFAHTRQQALEHVMDRFQDLLSIDNETLEDAKKMEDVYDEVR
DDPLYQHLLAMVNVHTAKQYGLDVPSDADKRMAEALRSDSWDNIEGQDWFKSAQSMAAEESFFHWELEFP
VAFYKTDGTRIEGSGFDAIIGNPPYGDILDETAKRYCRKQGIGFESERADVFTAFVALPEHILSIGGAWS
YIIPNTPLKGKQYQEFRRSNSQRYTIQEIVDFGDSYVFDEEVFTMIVSALNEEPMDTYAGSLVEGDSSSI
YDQPLSLSIEPATANPWRVIDKIEAKITGSETTLELEPAICTCHDAGIDYKVSGQGWQNRGKGTSISDLI
MYEGEKESEMDHRYVGGGEIERYQISPENKWLRHDYESFVEGDIVIQVYPNYTEVDEKILTRQTADTLVG
AIDTNELYTAKSVHTTLLNHDKYNLWFVLSLMNSSVLRYVYRSRSGEEGRTFAQVRIHELRDLPIRRIDF
ELAPDDRQNQLSELYEKFDSNISKENTLQIRTQRINQVVLHDFLSLLARKRSTYTDRRYGYNLNLLDYLG
NYADGPALPDIGLFQPTGENVLDATTEDYEKFQMFQIDEKLQVERARVKRDGSTVTIEATARYKPVDEDT
FETGSYGYTETDFLEAFTLTDLSDKEAALIEAFVPIAVDEEIGGFRDNATKNNSLVDRLKAMILPDPDAV
ADDLDRYVETKKRADELDAKIEKTDRLIDEIVYDLYDLTDEEIEIVESAVADD
>gi|299883434|ref|YP_003738986.1| helicase domain protein [Halalkalicoccus jeotgali B3]
MTDYAVGDHVKFAGGQGEITKIEDRPNGGQLLHVYTTEGQLRKLPGGLPHIERIDSIVDRLAAKQVDDPL
HHDLREHATRLDLAYRYDRFLSLTNNRIEIEPYQVQAAYEILNSYDHRYLVGDEVGLGKTIEAGIVIEEL
IARGRAERVLIVAPAPLAVQWQEELREKFDRNFVLYDRNTVQAYRQSHPNQNVWQQEDRIITSIDFAKQD
DVLEALRNLEEEWDIAVFDEAHHLTARRSSDDSTERTQRYMVGEAVANNSDALLLLTGTPHKGKSDQFYH
LVSLLDPYRFSHESQITPEGLEDLMIRRLKDDMYETDGTRMFPEKNIEALPVEMTPEERELYNNVTEYIR
EYYNLAQNEENQAAGFTMVIYQKRLVSSIHAIRKSLENRMRAIQNDAVAEDLPDDVQELIPRYSTEPETL
TDAERARVEEALEHVTITLNRSQIDAELGRVKQLWRQAKAIETDSKAELLREFVERILAEDPDEKILIFT
EYTDTLKYLRDTVFPEHDIAQVYGDLEQERRRREMEKFENEANLMLATDAAQEGLNLQFAHIMVNYDLPW
NPIRIDQRMGRLHRYGQDRTVEIRNLFFDNTRESDILELLLEKTDQIEADLGMRSDVLGRILENVDLDET
IMAAIAEGRPTEEVVADIEATIEERKEALETVENDFLIRDRFDLSDEDREILEIIERSRHGEVGEADIEA
LVREFFDEFGGTIKGVRPGPARSSGDIFRLEVPNVLTGDQIKSHYDTATFTKDVAMEEDEVDFIALDHPL
VQSLIDYCLDSNRVQGQIAVKVASNPEVTSGILFNYRLGYVSGTGDAITEKFVRLYATREGTITAEIPEF
VETLSPNDSVVNSCTTLDQLASKASQLHDVAEARAWDEVESFADEARTEREREIGIKREHAERYFTDQIE
EWEERLETYQQRAEQGTDMSAPIGNAQRELEQLRRQRDKELSQLEEEQHVTPEEPELVTAAFVISPEMRW
>gi|299883435|ref|YP_003738987.1| hypothetical protein HacjB3_19298 [Halalkalicoccus jeotgali B3]
MEVTVTYDLEVESDREAFMRTISELDHEEQREEDHGDEGRPPMPSEEHRMVYEAVKANPRHALRVYHETL
AEDNETPYDNFQQPDGWNDERVDIRSKMWDLKELGYVDNATQLWYPVEVES
>gi|299883436|ref|YP_003738988.1| hypothetical protein HacjB3_19303 [Halalkalicoccus jeotgali B3]
MNTNTTPTKEGIDKRTIRAATESMSIDRHAGEPGEYDVYSESGSVYRVCLITETCDCPSDTYQDGACKHQ
RRVEMALGQRDVPELDEETDVELMIAAREQYRGLGDSTVEHRPADDAVVVTDGGVAIESATQDDAGEEAR
ITGPHLEPPEQGGATYYRCEDCGRESLRRGDVERSEFHAEGCALR
>gi|299883437|ref|YP_003738989.1| hypothetical protein HacjB3_19308 [Halalkalicoccus jeotgali B3]
MARTSISVSEKLADELYDRKKRGESYEDVIWRLIEESEE
>gi|299883438|ref|YP_003738990.1| hypothetical protein HacjB3_19313 [Halalkalicoccus jeotgali B3]
MDVSADQNSLLTDTQREFLRMSEAEREEEFTKQLRSYHKRNILKRLHVGLPDISLILEELPIEDLKEAVE
YDSSFAAQEDTQSLSLSDLVTLAFVIESQLPYLETGAKSQQGRPERRAELMVRAGIMNALEMLGESWTDL
SVVVDRGDPLEELAEQDLMTLSDDELDQLRSAGFISREEYAEAILGASE
>gi|299883439|ref|YP_003738991.1| hypothetical protein HacjB3_19318 [Halalkalicoccus jeotgali B3]
MEITTIAVSPENADGLRAVRDERNLRSMDAALEQLLEKAYGETPTAESTN
>gi|299883440|ref|YP_003738992.1| hypothetical protein HacjB3_19323 [Halalkalicoccus jeotgali B3]
MSTHDTTPTTTELSNASDNDTDGNEAAETVTKRRVGKLLGEQRRRLSDDVIRDYDKINSDGHKVKTVKKR
DADGKKYEAEINLSQLYNPTPSTTSDIDILVIEARINDEADEGEVPIENPHIPVHDGVLERAEKRLDDEG
LTPAWGVVTE
>gi|299883441|ref|YP_003738993.1| hypothetical protein HacjB3_19328 [Halalkalicoccus jeotgali B3]
MISAPEDYTERRECVLARIGHPLADGDGVIAR
>gi|299883442|ref|YP_003738994.1| hypothetical protein HacjB3_19333 [Halalkalicoccus jeotgali B3]
MNETSDEEMNIPDTEERMVQVAVEVPESVRDGAKAKLPYGGMSQVIREELNRVAFGEEMGQRSRLESRLE
DVREERDKLQRERRELNAKLENLEDQAKDIERKLDDLTTQEDRYEAKLESLEYNIRIEGRNLFADHGQVE
SIAAEAGKSPEGVIKDLKHRNPDVPDEAFLSGLDGGGGFSPPDKNPKSSLKSAKNIGYGKDGEMRPLEER
EEKYRPRDPDADN
>gi|299883443|ref|YP_003738995.1| hypothetical protein HacjB3_19338 [Halalkalicoccus jeotgali B3]
MGEDGNNEKGSESTPKSDHNTTGNDIDEDGEAPEASKEDVQNQSEQSKAANPEPDPQGPETNESAINESA
ATEEPTSDDVAISGTELTTETNAATVTGTATNEADEPLTLDLEVQFLQEGEQLGRPALGGTTGLAPGDEW
DFSITARGSGAGEATDYEIATYVRTQG
>gi|299883444|ref|YP_003738996.1| hypothetical protein HacjB3_19343 [Halalkalicoccus jeotgali B3]
MTDLSTLSRRGFLRGTAGLAVAGSLAGCYYSTSGSDSGNVSSGGVGSGFAYEQPDVSREDATHVVRSPDQ
FDAALDEATHENPSIVWIPADAAINYSGRSRVVTNAVIASSRSVNHPGGLIYSNTMGGTSEAYRGGPVDG
VLELGANSRMTGVRYRGPTSATWEHPLYPGYIPFGSGPAPDREEYRSQRHSRGISITSGNVRIDNCEIFG
WSTQAISVNCPRSWGRERDQSHPRIQNSSIHDCGLSGYGYGLEVNTGHPVCERSYFNGCRHMVAGEGYPD
CGYTLSGCFFGPAGSLFPIDMHNLAENIGGTTNPDDYEYRYRSGGLMRVLNCTVAFSHVIDIASTESGSL
SAGGNPFAGEQTSAISIGGLPAQGVQVAGCRFVHDSPDSAFSQGLLPRHAETNQFGLARWESKNNQFGLT
ANFPVGQP
>gi|299883445|ref|YP_003738997.1| hypothetical protein HacjB3_19348 [Halalkalicoccus jeotgali B3]
MSTESNPGLLRRLFNLARFVVVGLIIYVVSMAILMGLRGPIIAASSSGTFTAIFGAWVLATLGIIAAIK
>gi|299883446|ref|YP_003738998.1| hypothetical protein HacjB3_19353 [Halalkalicoccus jeotgali B3]
MTMLASPAAAQTQELGNALCGSGAGWVVTAAGILAAVYLTGKGMIRGIGAIDDAGSIDDSKRDMARQEAK
GAGASMFGGLVGVPFVGAMLGQLLPESFGCIGFELNLLIVTLPF
>gi|299883447|ref|YP_003738999.1| hypothetical protein HacjB3_19358 [Halalkalicoccus jeotgali B3]
MPSVPGPGDWLEGAIEWIWADIQDGVAGYADELNAAFVGIAAPGEPTSPSSWIMPTGMWNVPAAFYVAAT
SMSAPLWAAGLIYMFDIKSRQKQREILRTLIYSAFATLTGMVLLGLYFNGINTISTAIAPGGNEFVQNGS
GIVQLGLGHIVVLVLMAINAGVVIVGGLIMYGIYMLPLVLFAFFPFIVASKAVPVKPLQSTANLGLTALG
MLPLLRIIQSLLLRLADMMIWDAVGLGTQIASLLGTAIILAFALLGLPWIFFKNIETASGLALSTITVKK
ANRGASTANNAATSAGSRAKSRLKSAAAPYATKARSTANQTAANAKQRAGSRMGGAMLTAKFGRPGSSCS
KRSTGTSPSSTSQGSASKTTNSEANSSRTARNRAINRQRRDAVKRRRRSRSDD
>gi|299883448|ref|YP_003739000.1| transfer complex protein, putative [Halalkalicoccus jeotgali B3]
MADTNDIRGEQTREKDPTQLSLPDIDASIPIVSRFTLDDILFLAPAFGVTAFGGVLVALGAPLAVMIPTT
IIGLVAGLGGAGVVLLTHEYTSPSERLTEWRRYLGMRRQMPVSDTVAERFDHHGVRRIFDDGTAEMDDGT
LVGLVRVDPRTTANMTYGELDSLVATLSRNIDQRVKDFDFSYYSTTRDHDLEETIGTYNERAYSGVLDRA
AGYMGEFMRGVVEWFEEVDEPAEDPREMHHYVTTCVAPDDVHVRDSDDDSGFQRRKAQQREMYDRLDTLE
SKMFAGVTGVATECVSAEEHAEVLLAYWTGEQHEPDERLERKFNRSEDGPSVWPDARLFKAGDEESGTVD
DLGSEAARDRLQTGLSQDREEFVGSDMALAGSHFDAKKSYVEVGEQYAATLWIADYPTDIESNFLKPLYA
MDRVDGVDLDITIDATAVDKKQAQEELQDGEANINAKSGEQSRIESRGTREGGNVYEDAGELLRNTNAQA
WDISMYVTVRAGPRAALGLAESEHRDFDSWDAAKMGALQEGIADVKEILESSPVEATVLRPSRMQRELFA
SCSPNKGNVFNDVLSDDSDPGMVERRLSTLLGDAGTSGPKQKRVLGGFLGAAFPPCTATINEDGGLNWGR
DVETGLPFRTNPAERGSSPHMITLGITRSGKTYGASSAASAWYAESDDRTLIVCDTQGGFTGLTQMLGGE
HIVIEGDKTINPLDVQAPPEGNQDIDAYRMSVDLATNFFKSILESQGVDASEYHTIIEDGIERTYRDHGI
SPGNVESDENPTVSDLLTTWEDMGENPGDYTVSSADSESDVREDRAAELLAKLSGFSENGKYHNLLGETS
LGLIDTDVSMAYLDLSQFNSDTDAEESAMMSLAQSQVTQKIRRTEGEVMFLIDEAHQLLHNDAQVSWLQK
QFREVARYDAIMWLMSQHPSEFVSSNSSDSNADKKQALLDQTSFKQIYNMPMSTTETEEAIREMVPNEAI
VDTIKNDLTPARANAGYTEFVCGVTDNDIPGWHRVRAEASPLEDYVLNYDADDHGEFDRYMSRFLNGSAL
APVEQQFHEEDEQSGELEDEDTADAIAASPLTEMYANAEADD
>gi|299883449|ref|YP_003739001.1| hypothetical protein HacjB3_19368 [Halalkalicoccus jeotgali B3]
MRPEIRRRDTWSFNEGREIVEKKGLKEELPAIAEAYIDYGGGNQYLSDRRELLDPLGWEQEVSVKFETTT
DYDVVSRRASFDAYNDGVVVEHESGEQMRVNWHLMKMEIAHRDPNVFSMGRTADAGVLLIPSYVNFPTLG
RTENDVQAVLEQYFDFSIPLFVWEYPTE
>gi|299883450|ref|YP_003739002.1| hypothetical protein HacjB3_19373 [Halalkalicoccus jeotgali B3]
MTGDNDSGRTKRVTFYVSENEQNALKREAQEQDKSLSAYCLQLIRRQRQLDAEEQLAEDLNVEQRLEEIT
QQAIDRINDSVGDVEETAEDLRDIHARSANYPLVNFRLLMRQHSPPETWIDDQFTWSRNRLREPLAEHDP
LDGLMTDDSSDDSSDESEDRDDGKVTDIDDLI
>gi|299883451|ref|YP_003739003.1| relaxase/mobilization nuclease domain-containing protein [Halalkalicoccus jeotgali B3]
MHGDDRDTIYKTNYRDDEGTEKLTNYLQHDNQKVRDRTGRAMSDREIEQFNDKAAGRRNRHIIISPRDHE
DLSDRELDRATREYMSEMIEDRPTADYAYAVHDDKEHGKDVHIAMTAGDKQDLEMYPDDIRRERKQAHEA
YLEYGRDRTQEQEQEQEQEQQNDRGRDLGGGRGR
>gi|299883452|ref|YP_003739004.1| TraD protein [Halalkalicoccus jeotgali B3]
MPTPDEDTFVLPIKVTSADAEDINSWFVRGMRIPRRSLLTLGASGAGKSETLKHFVDQLQNEPNEPVVVY
DHKTDYQEFLEERGVDMIRLSSGGSTGGDGSEIAWNIFEEIEHEEDADELARALFPEQNGDFWNAAGRQL
FAATLKYIRREVVGPDNADLVRYWERTVPEKMHEKLTRDGHEDLAAAASAINPETERQAGSVFATAQQQV
TDLFVGDFAKSGEFSIREYMQNPDGRVLVLDYPTRQSGTIAPVFRYLIDQAIMHGMDDPGRSAYYLLDEI
EHLDATIKRLGELINVGRGVNCQAILSLQSIAQLEDTYGKERAHALLSGMVTVIGLRTADEESVDFLRET
IGTSFEQYTRNAGSDRTPRENEEKEEYQFAKGDLRNFDPGEAVICRQGSGWVHGQIQLLEE
>gi|299883453|ref|YP_003739005.1| hypothetical protein HacjB3_19388 [Halalkalicoccus jeotgali B3]
MAVKEMCRWTSMRKPTVKCSLLSTMIAKHRWGTPIGVDELLRLSPLDNQEYPKARECVDELRSENYINNY
GDRIGLDNSHFGELADVLYYECEWEPYIIDTRLKHYEGIDTHDWS
>gi|299883454|ref|YP_003739006.1| hypothetical protein HacjB3_19393 [Halalkalicoccus jeotgali B3]
MNPTTLRLSESTLDTLADEADERGLSRSEYIREIIRERHEDDRLHDRLRADYERQITDYEEKIRDYEEQI
RDYEERITDLETENERIHNEKRLILEQREENTELVEYVEEQRELTQYQERRQRLLDEANILRRWKWKLTG
VPVDRKDE
>gi|299883455|ref|YP_003739007.1| hypothetical protein HacjB3_19398 [Halalkalicoccus jeotgali B3]
MTSDPSAVAQSIVVHAETLCEREDHLWDVICQLSIPVDDLEDARDQNRVDFETDEMFRTLLFKGIRGISQ
NELAQQLGRKPTLVKSFHFDITDLKKTPTQQQLSYTHAQFSEDTQEVLNRTVAGVRQVALDNDVVTEALV
PSVPTETEEEVSQSTSEYKKEKAQKTLTLARKHVIPEFDTHRAAHKTYSDEVMLDMFASICANNGSAHSE
AEYGWLTDDDLTCDDSTFLRAIKKIATPEDSDDQLTFEDFEDDDSMPEIDQIRDAVMTAFNAATENIINS
IRGDDPFDSRETVAAIDITHEQFHVWPWEDKEAGVAKPDYPKMVSGYKKDGEYERGYKYATITLVGDHAP
IVLGIEPVKEDSTWERDCSPSYSKADLVSRLLDRAEQFVDLDMVMFDRGFYANRVYADVDERGLTYLSPV
PTYEDDLAAIQDIQKHPTADAAVKHDVPFGIDGDVHHKAEFLYTPSTSDDADGKYAVFVTNQDHVEPEEI
ASVVNGYSRRWDIENQYKSIKDFLPKTSSTDYRLRLCNFALSTLIYNLWRLTDYLIKVALDKPIRSPPVI
TAKTFVRALGDFLREFG
>gi|299883456|ref|YP_003739008.1| hypothetical protein HacjB3_19403 [Halalkalicoccus jeotgali B3]
MGYLLVGFIVRGGECVDTMGLDDLEGFLRQKGAPELVTEIGTGTATFNALVDAVAVSSSTVSSRLSEGVE
RDIFTVSHRPTEHGTEKRYELTLLGRRIYDWAEKTEFERQVRELRRLRHERDTSFEQLIGKLNRDMEIRK
MVADSDPLEGKDVDLPEDASLVPKAPSEEELREAKFERMEESLEPIADDQAEGSSE
>gi|299883457|ref|YP_003739009.1| potassium transport system protein trkH3 [Halalkalicoccus jeotgali B3]
MSAVSIIVAVVNGEFYATPAFAVTAVTLGGFGTGLVRWYRDADPPEKRDAMVTAATAWAVIGFLGGLPFL
LVAWTIQIDPFPVWMNTPPMDDTTVIFLNPLDAVFESMSGFTGTGLTMAAVEDKLPRSIHWWRSFIEWVG
GVGVIVLTVAILHRGGGSSGSYTLYESEARSEKIHPSIVTTVQEIWKIFVGLTIGSIILFLLVGMPLWDA
INHGMTGIATGGFSVHGASIGHYDSPLIEYAVVPVMFAGSIAFPIHYLIFKGELRNFYADLQTRWVFIWF
TAGSLALAAILYANGQYDTLEHTFRASVFQFVSAVSNTGFGTETIGGGTDRVWDTGATLFMCLGMLTGGA
AGSTTSGLKIIRMVTLFKGTAWQIRDVFEPSSAIRYLKIGDRRLSEEQAQREYTEATVVFILWILFLIIG
VAVLLRVLSPGHPLEYVIFDVMSAQSNVGLDSGITGPTMPDTAKAMLIINMWVGRLEIIPVAVLLGSIFQ
RLNLYR
>gi|299883458|ref|YP_003739010.1| hypothetical protein HacjB3_19413 [Halalkalicoccus jeotgali B3]
MSDDSEPPDVRITVPRDTSDSDDNSYLRSGPRIQTPDYLVVVPVTGTLLDTYTGINVRRFLRTAVALAAD
NDGRVLLVGMEAVQDESALEPVREYVQSEDPAASDKPKVVEAIEDRQTQLAEMADVAQELDPGVSVTASV
RAVSDITSGILSVVNGGNETAVLLLRGTGLDEGWLLNRSTVDTILAEAECDVFVENMGVKSGENTLYVPD
IEGHTVASLAESEAETIDSILLPVGAGPHAALAAEAARAVARHANASVTVLHVISPDASAEATGEGEDLL
KFADYVLGSDVTTETELKTASDTADVIVQQAKDHDFVSIGAPEQKSRLKKIVYESVQETVSELNEATVLM
SRDSDRTARSLYYRWKRGIEAIEDDDNDKN
>gi|299883459|ref|YP_003739011.1| TrkA-N domain protein [Halalkalicoccus jeotgali B3]
MYVIIIGAGRTGRTVIDLATQDDHEVVVIERDTEIAEEVSATYDCMVINADAASKDIMLEAGVEEADALI
STTESDSVNLMVTMFGKQYEVETLVSSINDPAHMELFEDLGVNIVESPHQLNGQYLYRAVQHPAIQDFMP
IAGEAEIFEATVEDGAPIAGLSLIDADREDLLPEETIIVAIVRDDELHIPKGETEIEPGDVVTIFAGNGA
DRQITDIFTRT
>gi|299883460|ref|YP_003739012.1| cation transporter [Halalkalicoccus jeotgali B3]
MIRDIGALQVLIGGLMLVPLIVSLLYQEWYSALAFLIAAGVTAIAGGAMYKLCEDAPEPQRHHAMIVAAL
GWLATAAFGAIPFVIAAYITPSAVLESFVPAGASYQSSLLNFQNPLHAFFESMSGYTTTGLTMSVHEPSV
GHGFLWYRSQMQWVGGAGMIVLSLAILRQPHGIAGISLYQSEGRSEKLRPSIAGTARAIWKIYVGITALV
AVYLAVATFIVLPGYGIEQTIFDALNHAMTGQSTGGFSTLDNSIAGYNSYAMDIVHIPAMITGAISIPVY
YAAASERDIREFTRDPQVRALFGLFIVGVVGLTAFLARWVGVPYNGDPLGYVGRVATSQAFREGLFQFIS
AQTTTGWQTSAIGDWNNGAVMFIVFGAMLLGGSAGATVGGIKILRGYIVARGISWEVSRVFLPDHAIDDL
RIGQRIFKADEANDEIRAAGTMAAAYLIVLALSLFVLLAVLPSEFTLADAIFEVATAQGTVGLSSGITGP
GMPVIAEILFIIQMWMGRLEIIPVLVLITSLFRR
>gi|299883461|ref|YP_003739013.1| TrkA-N domain protein [Halalkalicoccus jeotgali B3]
MYIIIVGAGDIGTPLIDIATRSGNEVVVIERDKQRADAVASEYDCLVLNADATLKDTLNDAGAERADGII
STTDQDATNVMVALLAQELEIPAIVSVVHNPEHMNLFRQIGVNTIENPQQLIAGHLYRAVARPAIVDYMR
IGEEAEVFEITVTEDAPIAGKTLTEAGEEGLLSDDILIVAVGRESEEKPLTPRGNTRIKANDLLTVYSGS
GADPEITDIFGHYEDRTI
>gi|299883462|ref|YP_003739014.1| UspA domain protein [Halalkalicoccus jeotgali B3]
MTESFFRQVVVPVANPDDAEATAATLVPYVEGTDSTVIAVHVIEKAGGAPDKASVEQREQWAQDMFAAIS
DGLSDTGIALETKILYGTDIASTVIDAAHELDASAIAFTPRGGSRWRKLLTGDVTHNLVNKTDVPILVLS
DGEVNEQ
>gi|299883463|ref|YP_003739015.1| hypothetical protein HacjB3_19438 [Halalkalicoccus jeotgali B3]
MPFVLTVPVIDIGFPFDPVGEWPACLACFIRALYDDDRVCAVVFHANEFFPLSCFDRIGEWRMVPKELLR
VMDDLPELTVTAAFECSRNFLGDIFGRVDFGWSHEL
>gi|299883464|ref|YP_003739016.1| putative transcriptional regulator, AsnC family protein [Halalkalicoccus jeotgali B3]
MGYHIDEIDKRILYYLALDARNTSTSDIADEMEVTAATIRNRINQLEEEGILRGYLADIHYKAINGLVTY
QLRCTASIPDRSRLAQAAREISGVITVRELMAGSANLVVTVVGSDTAHINQAAGELADLGLEIEEENVIE
GEYHTPYNPFGPENVPKGPSLTDFMSLAGDAEVVEFTVSEGAEVAGLTIEQAVEEGLLADEMLVVGIERE
GDVLTPKGETTIQKGDVISLFSKTGLEKDALQVFGTQ
>gi|299883465|ref|YP_003739017.1| hypothetical protein HacjB3_19448 [Halalkalicoccus jeotgali B3]
MSSKSTDPTAEPQILGFLDQNGKSTVHEIATGIGYSNGHVRHVAKRMAKSGQIEGEKSSSVPAYNIKGDY
VVLPDNKDRLLKIVKAYASSHYPNVKGKPTTEIRDYISANIANGVVDSIGRWEFWVDTETTAAE
>gi|299883466|ref|YP_003739018.1| hypothetical protein HacjB3_19453 [Halalkalicoccus jeotgali B3]
MMGIFGNIVNEFEEDDVFINLSTGSKITSIAGMLTTMANTGITPFYTNAIYDDDGKVINVTGVTELPVYP
IDPPEPQHVKILKYLTENGKSKKQELIRYAEEEGLPFIGEYNIKEDRAKYRLLDTHIMSYLLDNRYVHVR
SVGREKQVEITNHGKDTVRAFEYLIE
>gi|299883467|ref|YP_003739019.1| ATPase involved in chromosome partitioning-like protein [Halalkalicoccus jeotgali B3]
MVNAIQRATTYVPKGGVGKTTSTAHIAVSAHNDHGLDTLLIDLAGTQNDLATQFGLADDVRDPDAPISAV
FSENWSFIRENIDNVFERMVFETDEGPDLIPADNGLGAEDNNLANVPRENRYDRLERFITDEVAPRYDLV
LLDLPGKEDNITINGLFAAENVIAPLKPGEFERKQLENLQRELAAIRDDGDHDAQPMLQLVFATMVDSTT
NLADEFTNVLAEEYPKISGPPISESANIGNEQANGRTLFALSDDELYDTGRRAREAYRQLTTSLLERLEA
R
>gi|299883468|ref|YP_003739020.1| hypothetical protein HacjB3_19463 [Halalkalicoccus jeotgali B3]
MSNDKDKAEKLLQESKGQSRHKTEPESAGTPTLEDAVADAYRRLENNELPSNITLRDDNLAALFVGLEKS
DELSPLGEATADALGREATIDTRADVLRLLLRYAISEIDGSILERGKAGRTQYLTEDDDF
>gi|299883469|ref|YP_003739021.1| hypothetical protein HacjB3_19468 [Halalkalicoccus jeotgali B3]
MTYFLVQHFMEYPPDVAQGQMAPIPSTLLQYIVDGLPKQDDEMDHQ
>gi|299883470|ref|YP_003739022.1| PilT protein domain protein [Halalkalicoccus jeotgali B3]
MYCPDTNFLIDYVDTEREASEDAKALLESNPDRAYRIPSVALFEVLRGGARLRGAAGVADLIEQLDWADH
LPLTPPAAREAVLVDGELETSGQKINLGDVLIAGTVREASGTIVTRDSHFANVDGLDVKRY
>gi|299883471|ref|YP_003739023.1| hypothetical protein HacjB3_19478 [Halalkalicoccus jeotgali B3]
MAKPGPSPTVTPEDVLEEFRSRDDPNEPLTAPEIADRLGCSRTTALNRLRELAERGDVVSKKVGGRSRVW
WLPPTEFDRDLLKGYGSWTGTDLGAAVEETRKQLDEDLREDERVLS
>gi|299883472|ref|YP_003739024.1| hypothetical protein HacjB3_19483 [Halalkalicoccus jeotgali B3]
MTATADATGSSTVEALAQTVEELQETVNEQAERIEQQAEKIERLETEIEVQSSNVGGCHLRVSDLTERVD
DLEDSHTQPDPTGTTAGDGRETSAQSDQTPLERICGLPEHIVDRELTANQKRARFIAKDVRDYAEKVPAG
LFMDSQTITKVIAAAESKKPHTQTVARVMDFLDELGKDDIKVKKRQGKKFVVVDPEAANRYHSRCDRGDG
ETPGERVIGTV
>gi|299883473|ref|YP_003739025.1| hypothetical protein HacjB3_19488 [Halalkalicoccus jeotgali B3]
MKDYMLWLKASQTVLMVRKQVGRNTGHSGRVNLSGSELTDLDLDIGDTIEIDVADTKEIAHALINSKESD
QFLIVTPV
Markdown is supported
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment