NS_000194.faa 1 KB
Newer Older
1 2 3 4 5 6 7 8 9 10 11 12 13 14
>gi|189485780|ref|YP_001956718.1| hypothetical protein TGRD_P3-1 [uncultured Termite group 1 bacterium phylotype Rs-D17]
MWNEIKTELTEKIPTIWLEPVKEESFKDDILMLNVPNRYYAEKYKTDFKELIQSVIKTKIGKDIGLQCQI
ELLPEPITKDKKPKTTSKTPLIKETKFNGKPYFESPAELTEISKEISQAKEIDVDNTKLTSMPVKYSIKD
VVSFSLLNSKMFTYPNDKRKKTKVEINIRFNNGTIKPLDLYRGQLDFNDEGYGQLTTTHAKIFLAITHIW
QKQGCKFANNSYLAVVDISIRELAKQLGYQKFSGADYKRLLRKTKELADFPMILADMYEAHTFTLLYDVS
NHKLKKSRNNKNMLRILINPFIAKQLYERKVILRNPQCYKIKNPTAIKFLICYDKRIIKGNNLRLNIFEI
ANDLEVNINNITSVAENLKNAFQELNGYELNDSYSLHVELIKENKEWIVVADRVLKEKQQSLKVNCRTDI
ECEA
>gi|189485781|ref|YP_001956719.1| hypothetical protein TGRD_P3-2 [uncultured Termite group 1 bacterium phylotype Rs-D17]
MLSLKDNKKSFFSLMCLFFLVVCGCHSAKEFRDGYITGLADGYALSVNEFKYNAELAKIKDEFDWSKVDF
KSEMKMYLDENKDIEKKVYDDYVKNGRKV
>gi|189485782|ref|YP_001956720.1| hypothetical protein TGRD_P3-3 [uncultured Termite group 1 bacterium phylotype Rs-D17]
MPTPTPPLTPASPEPASQDKLKKIALFCPPLTQLMFIYGLGLVEGAIQASLPYLFSSPTIISTLSIMFAN
MPIVGAMWFALFAYRSEVSTLSNVLDWSLPALLVFGEFLYFCGVGAVSPFSHWLWSIDPV