NC_016888.faa 30 KB
Newer Older
Raquel Bromberg's avatar
Raquel Bromberg committed
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438
>gi|379009185|ref|YP_005266947.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MCMDGNSYEDWQIVAEQYAAQVKLYADHIESWSERLKTAGLPDATKAFERAVLALGMAYNEMLKASDILH
AEHDHDHFHVEAFNVGLPAQEIHDHDHTTDERTHGHHAHVHAHPHSHA
>gi|379009186|ref|YP_005266948.1| integrase catalytic subunit [Sulfobacillus acidophilus DSM 10332]
MSTIDQIKWLQAQGYGVSAIADFLGCDRKTVRKYLQQTNFSPTVPVKRPRTSKLDPYKATIDTWLAEDTH
HWYKQRHTAQRIFDRLREAFPDFPVSYRTVRRYVHERRRTAPTTGTLELEWHPGEAQVDFGQAEVIEHGQ
PVRMHALCLTFPYSNAGFLQLFRGENAECVVHGLVDMFHHIGGAPRRLVFDNASGVGRRIGDQIRLTDLF
ARFQAHYGVETTFCNPYAGYEKGNVENKVGYFRRNVLVPPPVITDLVVTNQALLIRSERDGERLHYKKGQ
PIRVLFGADREALRALPPQAFAPYRYTQVRTDQQGRFCLEGQHWYSSAPEYAHRALIVRVGAHSVEPLAT
DGRPMTHHPRVYGPGRSDSTDYRTTVHRVAQRPGAWRNSPLRSGLPESVRRVLDSASRADVQAALEGLAQ
CADRWGFDHAVRALEEAVAAGRIQTADVVALGSRLALGPQESVNGVDLRLYDTLLEGRRAR
>gi|379009187|ref|YP_005266949.1| IstB domain-containing protein ATP-binding protein [Sulfobacillus acidophilus DSM 10332]
MILPKARRERRERIASYCKRLAWSQTAVTLCEQAAPLQEAFLEEVMAAELANREVGRRARLLSRAGFPAH
KTLTDFDRRVVRLPSTITWDDLDQGTFISAHRNLVFFGGVGLGKTHLAIALGMAACERGQTVRFATVTGL
VVRLTEALKAGTLERAFMDLQRTDLLILDEWGYLPIDRAGAQLLFRVVADSYETRSLILTTNLEFSKWGT
VFTDDQMTAAMIDRLAHHGHLLLFEGESYRMQHALMKER
>gi|379009188|ref|YP_005266950.1| transposase IS4 family protein [Sulfobacillus acidophilus DSM 10332]
MMLGNFFGQMGDFHLTKYTGNPLGPFAQRGNAAEYAASEQWGIIGDHPYRLVVYRSRTPDPRHARTLDRD
IEQQRRGLEQAADSVREQEFACEADAQQALEYWLETTPRPWHHVSGEVVAETRQARPGRPRKDPAPGEIR
TIWRVRITIGAVDAARRQQELERRNTFVLITTVSAEVLPPAALLAEYKGQVHVERHFHFLKDPLFVDALY
VKKPERVEALGYVLLLACLLYSLVERRVRAAQVAIPSPSRRVLKNPTGHEIARHLESLLVTRDATGKRTV
ALPSILHATLVAILDALQMPITVFTEPPLREPPRG
>gi|379009189|ref|YP_005266951.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MVEHWLAIAATDHLTRDALRARVLRRRDQVQLTEDVTGQARQQQLIRMADRAIAAAQEIEQLAAAFNAKY
KAYALFTLEVTRTPYVPA
>gi|379009190|ref|YP_005266952.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MAWTEDAGRQVFGDDPADDRYRALWLYLRDSGFDDPVMADADAFRDFYERGGYPLTLIRLDPLANPDAVP
WLRRLYGLPADGDWDAIEAAVQDDGTRVTLWDPVTDHTFLAVL
>gi|379009191|ref|YP_005266953.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MIWELPSRDYEAVATGRRGALVLPSRIICCIECIVK
>gi|379009192|ref|YP_005266954.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MAHYQITLDAQTIQALVGQKDNALALLLIMSVWCCKSGPSPSSHNV
>gi|379009193|ref|YP_005266955.1| transposase mutator type [Sulfobacillus acidophilus DSM 10332]
MSRIPPSQQIQQRIHQLLARGLTGEGSVVAELLTLGAQRVVQELLEQEVTAFLGREHYRRGPRRIRGYRN
GYRVKRVPTAEGAIAVHVPQVRDTAEPFESRLLTFLTGHRDVLQRLVTEMYARGLSTRDIEEAFTDATGA
RVLTKSQVSELTETLWRDFEAFQTRDLRPFPVEYLFLDAVFEPMRRTGRTREGVLAAWGICRDGRRVLLH
LALGNTESYENWLEFLRDLVKRGMRTPTTVTSDGAPGLIRAIEQVWPQSLRIRCWAHKARNVLDKVPDAA
RAEVKAHLAQIREAATLADGQQAVQRFRDTFGALYPSALKSLEDDLEASLNHLRVPAAHRKYVRTTNLLE
RTFEEERRRTKVIPRFWTEHSALKLIFGTLDRASRRWQRLTISETEIKHMDQLRQELGLEAPTGCKTEQS
GETSSHVV
>gi|379009194|ref|YP_005266956.1| integrase catalytic subunit [Sulfobacillus acidophilus DSM 10332]
MCQILDVSRSGYYAWCHRPPSTRAQARARRVERIRAVFTTSGERYGSPKITAVLRREGERISQKTVARLM
HDHRLRSRVTRKYKATTNSRHTWPVHENVLNRTFSADRPHAVWMADITYIPTEEGWLYLASLQDLYTRKI
VGWAVDRRMTQDLVIRALDRAVIHSRPPAGVLHHSDRGSQYAAAAYQERLQQYGMTASMSRKGNCYDNAM
IESWHSLLKKELIYLTKFRTRAEAEVAIFAYIEIFYNRQRIHSALDYQTPAEADAAYHARYG
>gi|379009195|ref|YP_005266957.1| transposase IS3/IS911 family protein [Sulfobacillus acidophilus DSM 10332]
MANHYDREFKAQAVQLVLTQQKTGAQVARELGIPSKTLYAWVAAYKADPVEPFVGSGHLKAEDQALRDLQ
RRIRDLEEENAILKKAMRIFTNDRK
>gi|379009196|ref|YP_005266958.1| transposase IS116/IS110/IS902 family protein [Sulfobacillus acidophilus DSM 10332]
MTQFMGLDLHKNYIHGYVFQPGQKGTHFRFSNTPEEWARFLATRLTPETAVAIEATGNAFTIYDRLINHA
GQVVVIHPAGLKGLGAGRHTDRIDAERLALGTYTRVQVWVPPTEVRAIRALITQVRACRQQETAWRNRAR
NLLIRAGYAVPRTVALRDWLAAHATELDETLQMIFTSALTMAEQAHQEGERLRSEILRRLQDRPEMAWLW
SVPGLGAWTAAVVWAWLGDPLRFRSARQVGRYAGLDPSVHQSGEADWRGHISHHGPAILRQILVEAAWWA
IRARDNPLRAFYDRVLPRLGKRRTIVAVARKLLLAAWRVWREQRLAHEVDRRRYQKKLSAIRVTLRTLPP
YPLAERLQTLTGAQGHPGC
>gi|379009197|ref|YP_005266959.1| integrase catalytic subunit [Sulfobacillus acidophilus DSM 10332]
MKNMKEIERMVTMFSEGYAIAAIAETLHVDRKTVRKYVYQEDFSEPFPQRTGRKSPLDPFKPTIQAWLAE
DARVRYKQRHTAERVYQRLQDEYGDRFTCSYSTVQRYIKQLRAERPAQSTGTLELEWHPGTAQVDFGTAD
IYWQPGDTLVHAVKYLVVSFPFSNAALWQYFPGETAECVVHGLQAIWQRIGGVPSRVIFDNATGIGRRIG
EVIRYAELFERFKVHYGFDATFCNPDAGHEKGNVEANIGYLRRHVMVPPPILQSWDGANDAALAQAPTLW
TRPHYKKGLPIAELFETDRKALRALPTNPFHPVRYLRVQTDGYGKFRLDAHHWYSSGPEWARQELVVAIG
AFTVVPYTPDGTPITRHDRQYGETRTDTIDPRTTLHRLSRSPGAFRNSPLRGNLPEPLVTTLDTYARQDL
KGCLQALADVTERYGFDLAIQALENAVQHHQIAYPDILVRAARMAEWP
>gi|379009198|ref|YP_005266960.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MSTVSDFPMTRIRVHDWMSTDILGSREQGRRLRGLLVDHIHRQDPVTLDFRQIDVMTSAFADECFGKLWD
SFDHQVIRRTIVLTGLSGNNPAIFRFVLRHR
>gi|379009199|ref|YP_005266961.1| alpha/beta hydrolase fold protein [Sulfobacillus acidophilus DSM 10332]
MNLRLHAQFLREPGHPPLFVRQVTPEAPRAWVLFLHGSLVHSEYYLPWALALASEGFGVWLPDLRGHGRS
GGPRGTVQAYTDYLADIRRLVDAMQAETDRLPLYLGGESFGGLLAFLAAQEPLPLEGLVLSAPAFALQAS
LSPALRRAIAWGSMLVPGLRSLRPMGINGVSGHPDLPAIVRTDSLAIHRYPLRFLGELLAAQDAAIQGAS
AVSPPLLVMLGGADRVVDHRVTRQVLTQVPGPVEIHEYPEAHHALTGDYAEILAATVATFTSRVVPGTLA
WKSGASGTGRAESGVPRAWGWIHATDPGR
>gi|379009200|ref|YP_005266962.1| EmrB/QacA subfamily drug resistance transporter [Sulfobacillus acidophilus DSM 10332]
MRKWLVLGVVVLGLWMDLMDMTIVNVAIPAIQNDLGTSLQGVQYVVTSYLITIGVFEPITAYWADTQGMK
RMYLASLAIFTVASALNGLAWSLPSLIAFRILQGIGGGMIMPLALSIVSVTFAPEERALALGLMGLPLLA
APALGPTIGGWFVQFHTWRDVFWINVPIGIVAFIAALRALQEFPTTRKPLDLGGFVLAAIGFASLLVALS
NGPTAGWGSLEIVLLLQIAIFSLALFGLWEARHPSPLFDLRILRLRWYSSANVVTFFTMMGLFGVLYLLP
VFLETVGGLGPMDTGMTLIPLVLSAAITIPLSGLLLPRLGAVGLTSLGLTVMGLGTAQLMHLGLSWDAGW
LRLWVSVIGAGLGLGIMPAITVAYGSLPPAWMNQGSAMLNLMRQVGSALGVALYTTIIQMREPVYWTQLA
STVTVTNFRAQARLAAWQQQGIAHGLSPAQAHVWALTMMAHQLQQTATLWAFHNAFGAAAVAAVIGIGPA
LWLWGSRQVLRPPDARHTALGEPGGVT
>gi|379009201|ref|YP_005266963.1| TetR family transcriptional regulator [Sulfobacillus acidophilus DSM 10332]
MADNVRQRIVEAATRLFARKGYAGTSTREIVEAAGTTKPSLYYYFGDKEGLYTALVRDELDRLVHSFDLA
EDLPLGTALERFCRHYVTFFQSDVSTIALTFRELFGLGEEAIQRMAQGYFDGLRQRVAQLIARGVTRGEV
PPSVDPDYSALAILGILNIFLMRWILQGDAYDLSRVLTQIDALVRGWQIHPTG
>gi|379009202|ref|YP_005266964.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MNEPAISEDAVAQSLPTDPGLPAVDLWLEYHGMVPREHLYLATTRISWRSMRGTPHF
>gi|379009203|ref|YP_005266965.1| DNA polymerase III subunit beta [Sulfobacillus acidophilus DSM 10332]
MRCTVAQDQAAHALRHLIRVLAAQNPVPLLAGVQLDATGDGLRLTATDLTHHVVVEIPGTVDEPGTIVVP
GTLLHDLVHRLATATFSVAL
>gi|379009204|ref|YP_005266966.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MTLVATPADIRRQMVRLGFIASDEQLCITPTQLAGKRMPHFSWKLKLAIPMALWFTREV
>gi|379009205|ref|YP_005266967.1| transposase mutator type [Sulfobacillus acidophilus DSM 10332]
MASSITKKSRSEQTLTVPWVDILQDAEDGLLALSIRVGLQVLQQMMAAEVEQLAGPKGRHDPQRQAVRHG
TEVGSVFLGDRKISVSHPRVRAADGSEEIPLDTYHQFQDPTLATQAVLERMLYGLASRQQRHADAAFESA
MEQPGPSKSTVSRRFIQATQQALDRFLQRRLDDRTWVVVMIDGLRVADHMVVGALGIDAEGHKRVLGLVE
GATENHTVVTALLQDLITRGLTAAHGLLVVIDGAKALAKAVREVWGDRVLIQRCQIHKQRNVLDHLPKSA
ENRVRQRLRKAYQEPDADKAAQALEALAKELERDHPGAAGSLREGLEETLTVQRLGLPGLLRQTLANTNA
MESLNSQFRTHAQNVKHWTNGQQVLRWLASASFFIEDTLTRIPGYREIPVLQTALKSAVAHKPEQKTEQI
G
>gi|379009206|ref|YP_005266968.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MGARPFFAYAEASDVQEAFRAAVAEAQWLYGHSGDTGTIAEKDAVRVVTPPRPMTDDETCVWAETLLNEG
PDDPQLDWIEDKWAPAAAVRLNAGGWLFFGWAAS
>gi|379009207|ref|YP_005266969.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MRDSLWLTFTEALVAGQVATARTAGVSLAAALARAGHPGLAHRVMTVLDTVDPPQPTGGPVVRGSPPPSW
RWAPVLRLFLAGPQDTDAVRALTAVGYEIVPAVDAVDADAADALRVNLCRLVQQATGVALLPGWQHESEA
RLEAVVARRLGLAVHPVATWLACSPGR
>gi|379009208|ref|YP_005266970.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MALTVTMTKEKETKNTVRFLFSPLRKHDKSDLS
>gi|379009209|ref|YP_005266971.1| transposase IS3/IS911 family protein [Sulfobacillus acidophilus DSM 10332]
MIPMSQTYAPEFKQQVVREVRETGNAALVARQHQLNPSMVRRWVREALTAEYPDPQALSLAEENVRLKRL
LAERDLQIAMLQDFLRKKGMRW
>gi|379009210|ref|YP_005266972.1| integrase catalytic subunit [Sulfobacillus acidophilus DSM 10332]
MTELCEQVHAWAEAYPQVPLQVWCATVHLPRGSYYAWRRRQLNPSEDRRRAAVGRAPVGYSTTQTGHAVS
DDQIMAWILAILEQENPWYGYRKVTAVLRQQYGLIINPKKVYRLMKAWHLLWPDRPPKSRYPRKLARNWV
ITRPNQLWQTDITYGYIAGEDRFFYVQAILDVCDRSIVAYHIGLTCRAADAAQTLQRAVQARQTEWGPEP
PVIRTDNGPQFTAHVFEAQCQAFGLTHERIPVATPNANAYIEAWHALLDRECLSQEFATYAEAYAAVTRW
IAFYNQRRLHGALGYRSPAQMRHAVANGQAQWTPLCA
>gi|379009211|ref|YP_005266973.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MRNRPKMGANALERTLVSKKRGPNRAYVWLVLLGLWAEALGVARRFRANTVRQRTHACWKVGQYVWADEL
PSPDAVQRYHPQILLWDP
>gi|379009212|ref|YP_005266974.1| TetR family transcriptional regulator [Sulfobacillus acidophilus DSM 10332]
MSSEVRERILDTASRLFYAEGIRAVGIDRIVAESGVAKMSLYNHFRSKDDLVVAHLERRHECWKEWFQAA
LSKRTIQPGEHVQALFDALGEWIWQNNARGCPFINATLELADPNHPAQSVADRHRAFVRDFIAEQLRADG
IPPAQQLVDQLSLLMDGAIIGSVMGSVDATRRAAQMADEVIRAYRHDPQRNNPEPK
>gi|379009213|ref|YP_005266975.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MPNIKRSHFQSNPNFKACFAETHQTGVLDAKTKELMHLALVLALHCEP
>gi|379009214|ref|YP_005266976.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MLIVFDAYGTLWDVTALEVRCREVVGPDDAGPTRVLLRTAIPPCWPKA
>gi|379009215|ref|YP_005266977.1| sulfite reductase (NADPH) beta subunit [Sulfobacillus acidophilus DSM 10332]
MRSPRRDWEEGADIHRIEEIKRSSRHLRGTVFDELYHNPDPGLSEANRQLVKFFGMYQQRDRDRKTSLDE
AVYTFMVRIATAAGSLTAAQYTVLDALAQDLGHGSLRLTTRQAVQIHGVAKNDLPALVQRLTAHDLTSLA
GCGDVVRNVVACPWPDFGGPRDRVRAMAHLLSDHFKPQTRAYVELFVAGQKVWEAAEDEPLYGEQYLPRK
FKIGLTVAGDNCIDVYSHDVGLVFHPATDRWTVLVGGGLGQSQGVANTHAALAHSLGTITTEAVLPVVEA
IVTVQRDFGRRDDRKFARLKYLIEDWGLNRLRAAVIERTKRALDPPVPLDWDPETDHLGLHDPKVVGVWL
PQGRIRDTATIPWARTLRHVIAQYQPCLQITPQHHLLLVCTEAEEAGAIRAALVDGGIPLPETLSPIRRY
VMACPALPTCGLALAEAERVIDAVVAQIETKWQEVGLSPTDLRVRVTGCSNNCARSFLAEVGLVGAAPGR
YHVYVGGTVRGTRLARLLEERIPLDAVPDVLEPIFRQYRETQAPQERFGDWCQRMAVGRPPRQDLLEGAH
HHG
>gi|379009216|ref|YP_005266978.1| phosphoadenylylsulfate reductase [Sulfobacillus acidophilus DSM 10332]
MDKALDVDAYAARWETAHPRDILAEVAGWGGHWTLAMSFQREDTVILHWATMVGLSFDVFWLDTDLLFSE
TYAFYETVQSRYPVLWRRIRPALSLTDQAAQYGEALWQRDPHSCCFRRKVEPLFEALAGYDGWITGIRRE
QSPTRAQAPIISWDDRHGLYKLNPLATWTTGQVQAVTEDEGIPVHPLHSQGYPSLGCAPCTRPTRPGESL
RAGRWEGWDKFECGIHQ
>gi|379009217|ref|YP_005266979.1| sulfate adenylyltransferase [Sulfobacillus acidophilus DSM 10332]
MRNSSIIVHQGPPTVIRLDRDRTWDAVCLARGVYVPLAGFMGKADYEAVLRTMRLTDGRLWPLPITLPVP
DPSWAALKVGDVVELAGAAGFSGLLEVAETFRRNLAAEADFVYGTREPAHPGVNRLLAEPEGAVAGTVTV
VRWPARAFPELYWPDEVQSMLQKHRFRSVAFFQTRNPLHRAHEMLLKIALEQVDALVIHPLVGPTKSDDV
SASVRMDTYRALIANYFPSHRVFLAVFPAGMRYAGPREALFHAIVRKNYGATHVIVGRDAAGVGAFYPPD
AARKLVADYATEIGVTPLTFDAFGYCPRCDGIASARSCPHQSAWVTLSGTELRRRLIGGEPIPATLIRPE
IASILQEAYRIPPEEV
>gi|379009218|ref|YP_005266980.1| siroheme synthase [Sulfobacillus acidophilus DSM 10332]
MSSGFYPVLLRIKGASVVVAGSGPQAAAKVERLVASGVSVTLLAPKPGPALEAWSGQTMVEVARRSLSES
DVAGTRILFLADEARALAPDICPLAAQYRTWVNVVDSPVWCDFYSMAQMRRGNLLIAVATAGRAPGMARA
IRDHIARELGPEWEARIEDAARRRKEEGHA
>gi|379009219|ref|YP_005266981.1| uroporphyrin-III C-methyltransferase [Sulfobacillus acidophilus DSM 10332]
MPKGHVSLVGAGPGAADLVTVRAAERLAEADVVLYDQLVPGAVVDAWAPQAYRECVGRRAQGPPCPVETV
VSQLVGYARKGLAVVRLHQGDPGLYGRVADEILALIHAGVPWEWIPGVSAMLAAPAAAGIPLTRRSAARH
VWVTTAHTTDGVGLPRVPKDPAWTGVILMGRDQQTTIRDVLLAQGWDPNTPVVVVGAASQPAEVVYKTTV
RGLPVSIPDFLPTTVIVGAAAEFPVKEVRPPNSVKGSMDKD
>gi|379009220|ref|YP_005266982.1| 3-Cys thioredoxin peroxidase [Sulfobacillus acidophilus DSM 10332]
MDIQTVSLPRIGDPAPDFEANSTFGPIRFSQYRGRWVLLFSHPADFTPVCSTEIMALARRAPEFEQRGVQ
LIGLSVDSVPAHLAWTRNLAAHLGHPVPFPIIADLDMTVSRRYGMLHPGESTTATVRSVFFIDPEGVIRA
LVYYPLSTGRNIDELLRVVDSLQVTASHSVSTPVDWRPGQPVVVPAPATQQAIETPDDARQMGLEYQEWY
LRFKTIE
>gi|379009221|ref|YP_005266983.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MRAGSTSRRIFPPSAIYPRPPLWASYNEAEGHWGRLKRYVGGDPVPKICPLYPSY
>gi|379009222|ref|YP_005266984.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MCDIHESTKNVEHALSHIADLLNLLGDQMKDWVAIIDDHSELPDAANHLSNALKLVLDASLEVTRASASL
SSSTITITSPSDTHYAMPHNHSHPTDSHIHR
>gi|379009223|ref|YP_005266985.1| hydrogenase nickel incorporation protein HypB [Sulfobacillus acidophilus DSM 10332]
MMEPRIVEVRENVLRKNDRLAHHLRDQFRSAGVFVINLVSSPGSGKTTLLRETLIRLRPDFNVAAVVGDL
ATENDAKRLAESGAPIRQITTGTTCHLDASMIERAIMGWDLKELDFLFIENVGNLVCPASYDLGEDYRVV
LFSVTEGEDKPVKYPTLVSTSDLALVTKIDLADVVGFNREVFSQAIEEVRPEIPLIWVSARTSLGMDTWL
TALVDARNARISSRTEPFYQ
>gi|379009224|ref|YP_005266986.1| hydrogenase nickel incorporation protein HypA [Sulfobacillus acidophilus DSM 10332]
MHELSIAHSLIDVAQEAIGENQHNMQVMALRVRIGALSGVVKDALIFAWDIATEGTVLQGAQLKIEDVPI
AIFCPVCQEERTLTDSHIFRCPICNTKSGDIRHGRELELVALEVSS
>gi|379009225|ref|YP_005266987.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MAVSMVREEEMRLEEKLTNPATVASIVRLIDRLDEINYLLDAFIGVLRRGPEIADAVNEVIETLRTSVPE
NAGAFNETSETVTSIVNTKVAMDTLIVGSKVIRAMSQAWDDVKTAPPQRVGVMGFMRAIGDPTIQPAFGY
LLAYAKRFAEEFGQRA
>gi|379009226|ref|YP_005266988.1| hydrogenase (NiFe) small subunit HydA [Sulfobacillus acidophilus DSM 10332]
MATVIWLHGGACNGNTQSFLNAEEPTVCDLVTDFGVEILYHHSISMEFGERARKVLEGALNGNPPLDIFV
LEGTVILGPDGTGRYDMFMGRPMKDWVWDMAHAAQYVVALGDCACWGGIPATAPNPSDSRGLQFLKDKRN
GFLGPDFRSKAGLPVINIPGCPAHPDWITQVLVAVASGRADDIALDELQRPQTFFSTFTQTGCTRAQYHE
WKEPVEEFGQGTRKGCLFYEQGCRGPMTHSPCNRILWNHQSSKTRAGMPCLGCTEPQFPFFDLMPGTVFK
TQKVLGALPKDLPLGTDPVTYAMHATVARMAAPKWAKEDMFVV
>gi|379009227|ref|YP_005266989.1| cytochrome-c3 hydrogenase [Sulfobacillus acidophilus DSM 10332]
MNSETRQIGKKMEIEVHALGRVEGDLDVKVHVEDGVVVDAWTEASMFRGFEMILKGKDPQAGLIVTPRIC
GICGGSHLYKSVYALDTAWQTEVPPNATLVRNIAQACETIQSVPRWFYALFAIGLTHRNYAKSPLYDEVV
RRWAPFVGESYEIGVTLSNKPVEVYAIFGGQWPHSSFMIPGGVMCAPTLTDITRSISILEYFQQNWLEKV
WLGCSIDRWLQNQSWDDVLGWLEESSSHQNSDLGLFLRFCMDVGLDKYGAGPGRFLAMGTFFNPDRYRRP
TIETRNAALISRSGIYDGKTFHDFDQARVREDHTHAFYRGTGSLHPFDGVTEPIDPNEGRLLGKYTWAKA
PRYDIPGVGELAMETGPLARQVMAGRPGAESWQDYDPLMLNVINQVGPSVMVRVLGRMHEGVKYLKRVRE
WLSQINLHEPFYIKPPELPEGRGFGATEAARGALADWIVLKDGKIENYQVVTPTAWNIGPRDRNNNVGPI
EKAMIGSPVTNPEDPVELAHVAQSYDSCLVCTVHVYDAKTQRELSRFEVGSGSC
>gi|379009228|ref|YP_005266990.1| hydrogenase maturation protease [Sulfobacillus acidophilus DSM 10332]
MLSTAMTCIIGCGNLLRGDDAVGPLLVRRLWETDLASRVRLVDGGTAGMDVAFQMEGASEVVLVDACRTG
AAPGTLYEVPGEEVEIPPLTGTNLHAFRWDQALAFGRWLLKDRFPPKVTVFLIEAEQVEPGAALSSSVSQ
TLERLIGILVTRYKGVPPLTHES
>gi|379009229|ref|YP_005266991.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MRVELTRTGWLIFYEDVQRYIPTEAVRAEVKQGELRLSAARESQVGVLLLQRDTGQDRCRLLVSQVIPGD
TKPGIGRAEWDESVSALRIPLGTFGRWGYPDEALFAEVTVEAEDGQWVIYATVYFSDGARVHRVGRYFTE
KKAQMAARIIYGSINRDRENLLEGW
>gi|379009230|ref|YP_005266992.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MLIRPQPLGVFPGIVGSLVLPTPEIPPGPDVLADVLRGRFREIPLEWTFYRQAVTNVSGISETLADDAES
VYNRFVLNPTEESYRACVELEGDLKKLFEAVAWRLGWPSSAPPKPGDTEGEVRAYLLATQAHFLLDTGEW
WEGVKYLDEAVDAARSVSPVFAARLLAERTGIVRTQTGVSEEIVQAYRTALTLLEDSAFDSVRAYLRVEL
ASALQEMANGRKSLLLEAVHEYQEALKWLTRENDPESYALAQMNLALAYVTLPLDGEKARLRSAIAVQGF
REALTVFTHEAYPELWASATLNLANTLQYLPSTHPEENLWQAVSLYEQILAYRNAQTNPVGYARVLASLG
NALAHLGAFTRATQLLQEARGFFDSMGDQDGVQGVDEVLTEIMERRGQSGNDSLSKATR
>gi|379009231|ref|YP_005266993.1| nitrogen-fixing NifU domain-containing protein [Sulfobacillus acidophilus DSM 10332]
MQIEDRLDEFESLARQVDDALSAVQKLDQTAQEAAMKLKESLEAFERYALIRLVRRMRDDPAGKNILLDA
VGDPAIYALFLVHGIVKSDIRTRVFQALEQVRPYINSHGGDVELIRVENHTVFVKLHGSCSGCGMSSQTL
HNLVEKTIQEHVPEIEAIEVEDEESSGGQGAFIPLSAINLGGDWIQALEYAEMVNGVPYRIHRDDIDAII
VRFNEQVSAYVNRCAHMQMPVDKGLVEGHILTCPWHGYQYDLKTGECRTVPGLRLDPVPVRLEGGSVWVR
PRL
>gi|379009232|ref|YP_005266994.1| NHL repeat containing protein [Sulfobacillus acidophilus DSM 10332]
MGASALMNVKPVRWLGASAPGGLILPDAKPKRNQLYAPRHVFLDDQYLVVSDSGNHRVLIWRGLPADDHQ
DADVVLGQPNFETEGPGLLHLPTGTGIWEGRLYVADAWHHRVLVWERVPETINEPPSYALGQPDLQEIRP
NCGGAIGPLGFYWPYGIAFVAGWFFVADTGNRRVLGWKGLPEVGQPPNLVLGQPDFYSGLENRGQSAGPN
SFRWPHAITGDEHTLYIADAGNHRILGYSPLPDVDGPANLVLGQNTYYETREMPHVPQGAHRLRFPYGVS
LAHGILAVADTANNRILLFTGPPRTGVGVPAVEVIGQTNFEDSGENRWKAVGPDTLCWPYGLWLHNHLLA
IADSGNNRVMIWRVEESSHDTS
>gi|379009233|ref|YP_005266995.1| hydrogenase assembly chaperone HypC/HupF [Sulfobacillus acidophilus DSM 10332]
MCLAIPGRLIDVPDKDQPYATVDVSGVRRKINVELLKQEGVQPGDWVLIHVGFAMSKISEDQAEEQLRLL
AMLGEAMQAQEEVEGYKFGET
>gi|379009234|ref|YP_005266996.1| hydrogenase maturation factor [Sulfobacillus acidophilus DSM 10332]
MELESYGRCTLDRDGCSTCGDVAVPVRVVEVRDSEALVEDRLAQRSWVIVDFVPDTQVGEILLVHAGIAI
GRAQEEL
>gi|379009235|ref|YP_005266997.1| hydrogenase expression/formation protein HypD [Sulfobacillus acidophilus DSM 10332]
MKYVDEFRDPALIESTAAEIRRIADSNRVYRIMEVCGGHTFSIYRFGLNDLLPPNIELVHGPGCPVCVLP
MGRIDDGMAIADDPRVIMTAFGDMMRVPGRRGSALEMKARGMDVRMVYSPLDALKLAMQNPDREIVFFAI
GFETTAPSTAFTLMRARALGLKNFTVFSNHVLIIPAIRAILDSPDMRIDGFIGPGHVSAVIGCRPYEFVA
QDYGKPVVVSGFEPLDLLQSILMILRQLKEGRAEVENQYKRVVPWDGNVAALKALGEVFEVRPYFEWRGL
GFISQSALKLRSAFAPWDSEERFVVRGVRVTDPKAAQCGEVLKGVLKPHQCKVFGRECTPEHPIGALMVS
SEGACAAYYEHVYLRQVTGG
>gi|379009236|ref|YP_005266998.1| hydrogenase expression/formation protein HypE [Sulfobacillus acidophilus DSM 10332]
MKTRTIGFRDAQIELAHGAGGKATRRLIEGLFVPYLDNERLAQLADAAYVEANGQRLAVTADSFVVKPLT
FPGGTIGELAVNGTVNDLAVSGARPIALLTTFILEAGLPTNVLEPQVETMARAAQNAGVPIVGGDTKVVE
HGQCDGMYITSSGLGVVDPRASLSAKSVRPGDQVLVSGPIGDHGITILLARGDLDLEADLSSDTRSVWPF
VDALLSACGPHLRWMRDPTRGGVATALNELARDADVAVTIFEEAIPVRDPVRGACEILGLDPLHIACEGQ
FLAVVGPEAVDIALAALRSVPGGEGAVRIGEIGTEPSRTVIGHSSYGGHRVIDVLVGDPLPRIC
>gi|379009237|ref|YP_005266999.1| glutaredoxin [Sulfobacillus acidophilus DSM 10332]
MVELYGTRSCPYTAELREHLWWIGKPFTEYDVEQDSEARARLVALTGGITVPVLVENGNVVQIGWRGQGC
VAGEA
>gi|379009238|ref|YP_005267000.1| acylphosphatase [Sulfobacillus acidophilus DSM 10332]
MSESLVARRILIRGVVQGVGFRPFVYRLAQRLHLTGWVLNGTDGVEIHIEGSDGRVQSFIEALWQEHPPA
AQIAALEIHEAPFDHGTSFDIKPSRGQGTPVTRISADLRLCAVCRREMSDPDNRRYRYPYINCTDCGPRY
SIILRLPYDRPNTTMHAWTFCAACAAEYHDPENRRFHAQPVACPECGPHYVFRDAEGVITGDVESIAAAA
RALSEGKIVAIKGLGGYHLACDALNVKAVEALRQRKYRKDKAFAIMVRDLEVAQTLVTVDKDVEALLTST
AAPIVLAPARCHLPGIAPGNRQFGVMLPYTPLHYLLYDYGAPPILVMTSANRSSEPIAYQDDDAAARLSG
IADGFLIGERPIARRVDDSVVQIGPFGPMMIRRARGYAPSVVAQLPVVSTPILAVGADLKNSVTLVVEGQ
AMMSQHLGDLEHWAAFESFQQAIEDLRAVYGIREDDLVVVHDMHPEYRSSAYASGLPARYVVGIQHHRAH
IAAVLAERGAWDVPVVGVAFDGTGYGDDGTIWGGEFFVGSLTQGFDRVGHLRPATLVGGDAAGRSPVQAA
VGYLAQLASVQDWTQPPFEFPSRFKIASALFRKGVRCFSTTSVGRLFDTVAALLGFTQDMTFEAQAAIWL
EQLAWNGKGIATNEPSLWDGRELDFRPLLDTVVRDRLRGHDPAAIAYGFHHHLAYGIAQAVSHLARQYSR
HVAVVSGGVFQNVLLLSLLKEYLESKGIEVWTGSQIPVNDGGISLGQAALAWATIDRVVP
>gi|379009239|ref|YP_005267001.1| transposase IS116/IS110/IS902 family protein [Sulfobacillus acidophilus DSM 10332]
MHSTSTIDQRKAAVQGAVMGGVDVSQGWHYIQWLLPNGLSAGTPIRFVNTRSGFESMWARRPAGTRLVIG
LESTGAYWRPLAHWLRQQPGVTVVLVNPLHTRKLKEVDDHTPSKNDAKDAGIIARAVAEGRYLPWTPREG
VWSELATLAVTRRQQKADVIRWHNRIQGWLDVYAPEFRRVFKAWDGLAALWVLDTVPFPADVLAYPFEDL
VAGLLEASHHRVGRKRAQALVTAYRDSIGVPGHASARAQLAAYLAHWRAARAALAATEAAQQKLVASVPG
ADALRKIPGFGPVIIATLLGELGNLADYAHPQQVVRMAGLNVVSDNSGKHQGKTHLAKRGRGQARQVAYQ
AALVAIAHEGPARVHYQELRQRLAPKAALIALACKLLRIAWACWRHQTPYDAERAFARALTAAAA
>gi|379009240|ref|YP_005267002.1| transposase IS116/IS110/IS902 family protein [Sulfobacillus acidophilus DSM 10332]
MSRLFVGIDIGKYHHEVSLVSAEGKVLRHFRMENTQESVDRLWGAVTDVGASEVLYGLEATGHYWLALYA
ALTGRGARVKVINPIQSDSLRNLYIRVTKTDPKDSFVIADLLRIGRYTETVVPDETVLALRDLSRLRVEF
TVTLGSLKHQAHAVMDRIFPEWNRLWSNPWGPTARAVLSAYPTPAALAAADPGALTDLIREASRGRLGAE
TATQVQITAQQSFGVTYGLDAAVLSVRLLMEQMAFLEQQIQTLDERLAALIPQDTPILTVPGIGPTLAAA
ILGEIGDITRFASGKKLKAYAGLDARVHQSGEFQRTRTRISKRGSPYLRRALWLAAFAARIHDPGFRAYY
EAKRAQGKHPNQALGAVAGKLCMVLWAILTRNVPYDPAHALPSLSVESS
>gi|379009241|ref|YP_005267003.1| amino acid/polyamine/organocation transporter [Sulfobacillus acidophilus DSM 10332]
MDEDPVRSHERLHQVFHLVDLSSLSISSVAPIFSVAAAGSVMVRAAGPAVPLAIVLIALPFIASSGIFLS
LNQHFPNAGASYHWSRRILGFDYSNFQAWIIIMAYFWSIPPILIPAAQFTLSILGDNTPTNLLQIVVAMG
WALFATSVLLWGAKMTARVTQMFLVIEVVSVLVMGIWGYSVWGHVIHGGTIFAIGHIRWPGVIVCMVIAA
TIVDGWEIDSYAAEESQKPLIAPGWGGIIGALGVAVYYLTIWPILLHEVPLHTLETSPDVLTIWSKTVAP
GFLPWIRIAILASTAGSLWLTSYILSRALFAMSRDGVLPFWLGRLNRHKAPMWAIVIPVGSSAAVIVLQL
MFPSMNALFTLVLSAAGFFLVAEFLLDGINMAVFLLRHHATLRHDLKTHHHAVLFLGSLFVVLTLGLLEG
LFLVYGPRYIGPDIDWVTVVMIGVGLLHVLWIKAVRRQQTIVFNPDAGDLFAAGPVAWRLSQDK
>gi|379009242|ref|YP_005267004.1| RNA-directed DNA polymerase [Sulfobacillus acidophilus DSM 10332]
MDSWETRRQPNTSPCEGLVPEERVKPGGPSQAPSVSSASRPPPPDVSNNSLMEAILDGNNLKLALKRVRA
NQGAPGVDGVTTDEFVDYLWEHWPTIQGQLRAGTYHPQPIRGVEIPKPTGGVRMLGIPTAIDRFIQQAVL
QVLTPIFDPQFSDHSYGFRPGRSAHQAVRQVRRQAEAGAEWVIDLDLEKFFDRINHDILMARVARRVQDP
QVLRLIRRYLQAGLMLHGVSTPRTQGAAQGGPLSPLLANILLDDLDKELARRGLAYVRYADDAMILVHSR
RAGERVLASVSRYLDRTLHLPVNLTKSAVDRLVRRTYLGFKFLKSRAQYRLGIAPESLRRVKGRLRELTD
RHAPGRLTARIQAVNRFLAGWVGYFALAETPTPLRELDSGIRHRFRAIVWRRWKRVRTRYRELRALGVPA
WKVGELANARKGPWRMAAGPLNSVLTVSYWDAHGLHRLLNLYEATRLRWS
>gi|379009243|ref|YP_005267005.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MDEYDLVFSLAQYHEGLQSIDMATARLLKRRQKISHDLPGLPPKALVAQWAEQCQVSAHDLERVFVTLYH
LSESRHRVRPEGFRAFIPLARSRSQDGATYTILSLRQYDNASVVRVTVEVENNAPATMPGLMLDLDAPFR
AWSTHGGGSQSWIQQDFVVAPPLPDNVDGISIRLLVKPHPRPPHRGDLCSSEQIYEFTPKTIVF
>gi|379009244|ref|YP_005267006.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MDCTGIRNGFDDYPVRLPDDMLTVQGHHISSIIDVSRFAMERGRELETYIERLNDAIRNSKFRVHYRLTV
QHVAPAALTADLSLIHFVSCNLENTDFTGSTISGPISLDHCILDASLPPITVEPNELFRYPPSKAARELG
VTDPKDIMVLRWGLTQDARHVGQAFLWLERRYPKTEVVLARLLKGLPARPPRRMNWVP
>gi|379009245|ref|YP_005267007.1| transposase mutator type [Sulfobacillus acidophilus DSM 10332]
MASSITKKSRSEQTLTVPWVDILQDAEDGLLALSIRVGLQVLQQMMAAEVEQLAGPKGRHDPQRQAVRHG
TEVGSVFLGDRKISVSHPRVRAADGSEEIPLDTYHQFQDPTLATQAVLERMLYGLASRQQRHADAAFESA
MEQPGPSKSTVSRRFIQATQQALDRFLQRRLDDRTWVVVMIDGLRVADHMVVGALGIDAEGHKRVLGLVE
GATENHTVVTALLQDLITRGLTAAHGLLVVIDGAKALAKAVREVWGDRVLIQRCQIHKQRNVLDHLPKSA
ENRVRQRLRKAYQEPDADKAAQALEALAKELERDHPGAAGSLREGLEETLTVQRLGLPGLLRQTLANTNA
MESLNSQFRTHAQNVKHWTNGQQVLRWLASASFFIEDTLTRIPGYREIPVLQTALKSAVAHKPEQKTEQI
G
>gi|379009246|ref|YP_005267008.1| IstB ATP binding domain protein [Sulfobacillus acidophilus DSM 10332]
MKHPDQAYRTCVGILKIGQSHSAETLEAAAAQAVARELYTARAVTALAKHLADASSEPTAVPPHPNVRGP
AYYQKSEEESLMLPNATRDHLQALRLSAMAEAWARQQADPTMAELSFDERFGLLVDAEWVHRQNRRWARR
LREAQLRLAASPEAVGGCPRFRGISLAYPFS
>gi|379009247|ref|YP_005267009.1| RNA-directed DNA polymerase [Sulfobacillus acidophilus DSM 10332]
MRHPLVVLEQLQKQASQPDYLFHRLYRNLYNPDFFLLAYQNLYANKGAMTPGVDGTSLDDVGLKRIESLI
QTLKDHRYRPQPARRQYIPKKGGGQRPLGIPSANDKLVQEVARLLWDSIYEPTFSKYSHGFRPGRSCHTA
LAQIQHHFTGVKWFIEGDIKAYFDTIDHHTLVNILRRRIKDEAFLALIWKFLKAGYLDQWQFHGTYSGTP
QGSGVSPLFANIYLHELDQFMERYQATFNRGTQRAPGKEYGRLQGIHQRHRKHYAAHWDTMTPEEKDAAR
RHIRKLRAAVLRTPSKDPMDPHYRRIQYVRYADDCALRRQTAC
>gi|379009248|ref|YP_005267010.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MPRDEGRPLETALQEEVSNHRQRLGSKAPVVSVTEKAELDSVRYVLWELNASEPLRTCRKRRDVIKTGG
>gi|379009249|ref|YP_005267011.1| RNA-directed DNA polymerase [Sulfobacillus acidophilus DSM 10332]
MDKPKPYAISKWLVYEAYQRVKANHGAAGVDGESLRRFEEDLKNNLYKIWNRMSSGSYFPPPVKAVEIPK
KSGGVRILGVPTVADRIAQMVVKLTFEPLVEPIFHPDSYGYRPGRSAHDALAQTRQRCWRYDWVLEFDIK
GLFDNIPHDLLMKAVRQHTDNPWGLLYIERWLVAPLQRADGSQEPRTCGTPQGSVISPVLANLFLHYAFD
VWMSRRHADKPFERYADDAVVHCRSYALAAALKEDLARRLAGCGLEWHPTKTRIVYCQDDDRRDTYPETS
FDFLGYTFRPRRSKNRHGKYFINFTPAGSRTALTAMRQTIHGWRLHLQVHRNLSELARQYNPVIRGWLQY
YGRFYPSALYPLLRHLNRVLVRWATRKFKRLEHRQRRAEHWLGGVAQRDTQLFSHWPKVRPAVR
>gi|379009250|ref|YP_005267012.1| Group II intron maturase-specific domain protein [Sulfobacillus acidophilus DSM 10332]
MRLTLHPEKTRIVDFRDSAFDFLGFTFFWAVSKDGTGRPLFGPKQAAIERFKDKVRALTRRTRPMNLQMV
MDDLAPVIRGWGQYFTISHHGNYSRLDAWVRERCRAFVAKRWNRNPILDAEWPNIRLAQMGLPSLAMMRR
QVKAQQHPRP
>gi|379009251|ref|YP_005267013.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MRTLFRNGYTRPCGQSCLINPCSPSLTCRSGRPSHSRGVLLSRAVLRYYFGLRLPAPPDGKGLAVVALPY
FFNHRTRQGLTGSVQNLSKRAIPNHSTGLAGVFTHSTYILRCSAKPLRRRTSPSTEGWSRLPSHHGFTVR
YGSLICLRPTRFRITSDTLPLLAIPLEWGNSQEQDFHLQASVPASRTVGGVLLDPVPSSNRTGGFPTSGS
PTIVALD
>gi|379009252|ref|YP_005267014.1| integrase catalytic subunit [Sulfobacillus acidophilus DSM 10332]
MSASRRLPPLSLTNEDRTYLTQLARSRSARHTEVIRAQMLQAIADRLQMARNAVRRCVGKALALGPRQAL
KDLPRPGRPRQITPEARAWIVSLACQKPKDLGLAPEFWSESLLAQYMREHAVAAGHPSAQWVQQGTISKL
LAEHELHPHRMTYYLQRRDPEFDAKMVQVLHVYQPVEFTFDDHGQPTVRWSSDEKPGIQAFGTTAPDRAP
QPATGQGTWQRDHESVRHGTVSLLAGIDLATGEILGLVRPRHRSAEFVEFLPALDQKYPTGVKIQIILDN
HSAHTSRETRAYLATVPNRFDFVFTPKHASWLNLIEVFFAKLSKQLLKGIRVNSTDELADRMLAYIDWLN
QDPVPFRWRWTPKDVEDAHVI
>gi|379009253|ref|YP_005267015.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MWENHKSGSIRGRGSEEPLLLYLHHLGPTPATQSRVLRAAEARSQSVDGEPTPAVSYRSWIDEGGAPHV
>gi|379009254|ref|YP_005267016.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MFERFFNMTATPFTRDVPPETCYQSPAGSEVLGRLVYAAQRQWFAVVTGDCGVGKSTTIRRLTATLDSAT
YKVLYVADSKLTPRHFYKGLLEQLGYETKFYRGDAKRQLHREIEILRGVHGLHPVVVVDEAHLLDREMLE
EVRFLLNVQMDSQSPLALILVGQTELWDRLSLQAYAAIRQRIDLQCKLGHWDRAEVAGYIDAHLRYAGVD
HALFADPAIDAIFHYSGGTARLINKACTHSLLYAAQNNHRLVDETIVMRVIKGNWPNGCARTLGLSQKVG
RQ
>gi|379009255|ref|YP_005267017.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MTPSLKRAHFTPSSGGMRSFFSAFLGVKWEKFLGIKPFETPPVPPKLLVKVGRQLPDTQHHQISDKLAWL
LQHYHGWSNCVYGRSSGRRFDDYLLEIV
>gi|379009256|ref|YP_005267018.1| (NiFe) hydrogenase maturation protein HypF [Sulfobacillus acidophilus DSM 10332]
MTVTTDIRRVRFIVEGTVQGVGFRPFVYHLAQLYKLNGFVRNDGQGVIIEVEGPYHFIQTFRSKLVTDLP
GLATITRIREENCDIHHATGFDIQNSTQGIRRALTIPPDVALCPECRNELFDPSNRRFGYPFIACTQCGP
RFTVIETLPYDRMATTMADFPLCENCDEEYRDPGSRRFHAEATGCLSCGPTLELLTDDESLTGSVIDQVS
RLLAQGGIVGIKGIGGYHLACVAWNDDSIKRLRQIKARPSKPFALMARDLDTIRKFCVVTPEEEALLSSP
VAPIVLLAHRLDDSLLSDRIAPGLMKVGVMLPYAPLHALILERLKEEGYPPIVVMTSANHHGKPVIFDDH
TMDSFAHQVDGILRHNRRIQIPADDSVVQVADNGRPLILRRARGFVPSPIKLPTSVAISTLALGSHMKST
FCLTEGDEAILSPHIGDLDTTLVQDRYRYVLAHMLALGDVEPATIAVDFHPQYASSHVASAWPEAEIIRV
QHHHAHIAAVMGEHVITDRAVGLALDGTGLGDDGAIWGGEIFVARLTDFQRSCHLRYVPLVGGDRTIREP
WRIAATYLQLIFGDAWLQFPLEFVRAVPIKSWCLVKQLLERNVHNHPTSSTGRLFDAAAALITGRIAVDY
EAQTAMELEQLAREDVEPYALPVMARPLQTGIIDPFPLIRAVITDLLHHEDQGIIAGRFHKTLAWMFADA
AADVAEKQRIAHVVGAGGVMQNRVFVRALRNRLAARGYDLKVNEKVPPNDGGLSYGQAVVAQAILAARTT
QNPKIGKEYQPCV
>gi|379009257|ref|YP_005267019.1| hydrogenase assembly chaperone HypC/HupF [Sulfobacillus acidophilus DSM 10332]
MCLAIPGKIVEIENETEAKLEVTGVKRRVDVSLLKQQGIAIAPGDWVVIHVGFAMNKINDHEAQSMLQEL
HNLGPENYRDELMLWDLMSSDTHEPKEPK
>gi|379009258|ref|YP_005267020.1| hypothetical protein, partial [Sulfobacillus acidophilus DSM 10332]
MMKATWYLTIPAASHEDNEPVCVTCSDAAETMEIERVESLYEAVALSERGPVRIDVSLIETPHAGQKVLV
HGGVALGIVAEND
>gi|379009259|ref|YP_005267021.1| hydrogenase expression/formation protein HypD [Sulfobacillus acidophilus DSM 10332]
MKYMDEYRDKDLVARVSEEIARISDGMPIKIMEVCGGHTHVIFKYGLEDLLPANVEMVHGPGCPVCVLPI
GRLDDAMALAQIPGVIFTTFADMMRVPGSQFSLLDIKAQGADVRFVYSPLDALKIAQQNPDKQVIFFAIG
FDTTTPSTAVTIARAKTLGVTNFSVFNNHVMLIPALKALLDAPDLDITAFLAPGHVSMVIGMNPYEFIVR
DYDKPVVISGFEPLDVLQSVLMVVHQLRKGVRQVENQYSRVVSPQGNVLAQRMIDETMEPREEFEWRGLG
TIPYSALKLRAAFAEFDAEQRFAIPGRKVLDHPACQCGSVLRGTIRPWECGVFGTACTPEHPIGTCMVSS
EGACAAYYNYGRYSMARERQQLTGGKL
>gi|379009260|ref|YP_005267022.1| hydrogenase expression/formation protein HypE [Sulfobacillus acidophilus DSM 10332]
MGQVRRTQEEVLDNITKAQQARRRHMTLKQDIITMSHGAGGKSSHELIEGLIRPILANPVLDSLDDAAVL
PLSRFVSLGNGNLPELAFTTDSYTVSPVKFPGGNIGDLAVNGTVNDLAMSGARPIALSLGLILEEGLPVA
LLREVLESIAAHAKELGISIVTGDTKVVPRGKGDGLYINTAGIGIVERTWPMGQHLIQPGDKVLISGSVG
DHGIAVMLRREGLEMESEVQSDTQSLYDLVHHLFVHISSAIHALKDPTRGGVATTLNEMAVSSDVAIKVY
EDAVPVKESVRGACEILGLDPLTIANEGKMLVVVAKERAEEALSLMRQHPKGQDARIIGEVQEEPRGMVF
LQTVLGGTRVLDMLVGDPLPRIC
>gi|379009261|ref|YP_005267023.1| Sec-independent protein translocase protein tatA/E-like protein [Sulfobacillus acidophilus DSM 10332]
MWSNLLDPVHLIILLVVVLLIFGPRRLPELGSSLGKTLKMFKDAQKGLEDTSTRDQNPSLPKE
>gi|379009262|ref|YP_005267024.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MQTVESDTQGLLRFSRYAFPPNRLGYCGGEDHAGLYQYMAAQKVDGGLRDMAKNFEGAYPYLRLIAHSVG
IEDPLDERVVEAYWLGNTWLDRVAPYDFYRFLEQYYKKVMAPARFDMLKDSLTQGARPHHNFHVFGIFLY
LQKSLTGSVPRMERVLGAVDGCRISWGQVIAVIGNQLVVNRPPVMIKDDQWVIGKPVPVRVDWKLDHDGR
LAEVHAGDVVSIHWGWASERLRPPQVARLITDTRTFLKLANQRFLCE
>gi|379009263|ref|YP_005267025.1| hydrogenase (NiFe) small subunit HydA [Sulfobacillus acidophilus DSM 10332]
MDSSINWDDLPKVSGRPLEGITEHTAQDVQQAVREVDQRLNAIDPDGTVSRNFIARFIAMGLTRRDFIKW
SSMMTAALMLPPVFESRVARAAAVSTKLPVVWINLQDCDGNTESLLRTSDPGFASLILDTISLDYNETVM
AAAGYQAMDRLNEVIAKHKGQYVAVFEGSLPLGNNGTFYTTGANAETGISLTKRVVAGAKMVMAAGTCAA
FGGIPAAQPNPTGAKGIGDGLNIPVVNISGCPANAINLVGTILEVVMFNDNPALDRYGRPLWAYAHRIHD
NCERRGHFDAGEYVLNWGDTAAQNEWCLFKMGCKGPYTYNNCPQVRWNQQVSWPIRAGHGCIGCAEPNFW
DTMSPFEQPLGAKVYGSALGIGIDASANTVGEVVVGAAVAGIAIHATATWIRDKKSPGWKNPQSKDIPPK
PPLNQ
>gi|379009264|ref|YP_005267026.1| Hydrogen:quinone oxidoreductase [Sulfobacillus acidophilus DSM 10332]
MAQLKRFTIDPITRIEGHLRIEVDLDSNNVVKDAYSSSGMFRGIELIMQDRDFHDVGLFAQRICGVCTYT
HYRVGTEAVEAALGVQIPTNARIVRNLLHASLFLHDHVVHFYQLHGMDWFDVVAALSADPEKAAAVALKY
SPTPYNAGAGTFRAVQERVSALVASGELGPFANGYWGNPSYKLTPEQDLIMLSHYLDALAVQRTLAQAMA
VFGGKNPHPQSLVVGGVTSIMDIVDPSRVAEFLGKMQSGAQFIQNAYLPDIRMIADAYIQEAKSGEGYGV
PDFMSYGAFPIDNIPWPKGAMLFPSGVFNRNTGMVTDLNADQIKEDVTRAWYQGPNEGVYPGEESTIPDY
TGYEADGALNRSGKYSWIKAPRYQGLPMETGPLARLLIGRARKDPLIEKAMTDFERSVPRGFSPDEWYST
VGRTAARAVEADIIASQVGAWVDELAANVGQGQTQTYTAPSNTSGEGFRLLDAPRGALGHWIRIENGRVT
HYQAVVPSTWNASPRDHKGQMGPYEASLINTRLAVANQPLEVLRTVHSFDPCIGCAVHIVDSKGAEVARF
QVDV
>gi|379009265|ref|YP_005267027.1| Ni/Fe-hydrogenase, b-type cytochrome subunit [Sulfobacillus acidophilus DSM 10332]
MTEEKTQTPRHVLFSPATRWMHWLRVGLIAYLVVTGFEIGQPFILYNPLVPTWKDFLMNWIRGTHEMAGF
TLIATEIVRIYDFFRTHEFKDARIMFSKEAWKKQLRYYGLFGRQYRHPGVRYGPLQFAFYAAFYLALILI
SLTGILLFGANYNGPGFGSFIYHQLGFFYPLFGGLVGLRMVHIWLAWSIIFFVVGHVYMVIWNTVENRDG
TIDTMLTGTHMQVADSQETE
>gi|379009266|ref|YP_005267028.1| hydrogenase maturation protease [Sulfobacillus acidophilus DSM 10332]
MEKILILGLGNILFSDEGLGVHMAHYLQEKYRFEPAVDVMDGGTLAYQLMDHIALYDHVLIVDAALMSQS
PGSIFAFRYEDAVKWGWHITAGAHEIEIVGVLTSLKLLGELPDVQFIAMEPYDIVSTHIGLSPVVRDRMT
ALEQVIIEKLGSWGIQCTPVREVSFDRSDNDLLDIAPDKTGKENSHVFGASAQSRQGS
>gi|379009267|ref|YP_005267029.1| hydrogenase expression/formation protein HupF/HypC [Sulfobacillus acidophilus DSM 10332]
MCLALPLKVVKVLDESRCLVEGGGRTRHAFYDGIEDLHEGDWVLVEANLVLEKLSEEEGRQAMEDALRYV
FGNEDDEPSA
>gi|379009268|ref|YP_005267030.1| 4Fe-4S ferredoxin [Sulfobacillus acidophilus DSM 10332]
MLLIRLLLQRPKRIRRNEAVSRREFFQELLVLPRPAQHVKPEVLDPEDHPVVPVPRFRPPGAVAEKAFIQ
QCVGCGLCAEACPVGAIVPDDQGLAMMDVNRQPCLACADVPCSRACPHGALKPLEQAWEIATGHAVLHAD
TCWHLSQSQDCGGACLNACPLPHNALKLYPGQAPDISALICLGCGQCVNACPSPGTITMQPR
>gi|379009269|ref|YP_005267031.1| hypothetical protein [Sulfobacillus acidophilus DSM 10332]
MDWQVFRDAKESELAEHRAFVEQTLQWRVPGFHWSAASVKQWYEERSQWPEEIQRAVEFLYQYDYPLRVL
EEQIVSDESWLWNDYDGMRKKLMETENRFWQNTAASAAEPNTDESQSQDLSMLEWWQSVRGRRGPLLAVL
RSKLPLEKYLQHLSVIAQSNDYEAAEHIDDADHASLQLVPKRFVDLLRDVNPDVMRLLPLHMDLSREQGR
LSVTLTDWIGESTWPENPSEDVLKALAWFDVTGTIFLDSLGWVR
>gi|379009270|ref|YP_005267032.1| hydrogenase nickel incorporation protein HypA [Sulfobacillus acidophilus DSM 10332]
MHEAGLMASVLEIIDQSRVENNIRRVTEITLKVGVLNGALPDALQFAFDALRSEYAWLDASSVLRIESVP
AILLCFECHYQGPGSEMTCPACQSVLTQLIQGEEFDIVGFDGEVDESSKDRSLYESLGRGGQ
>gi|379009271|ref|YP_005267033.1| hydrogenase nickel incorporation protein HypB [Sulfobacillus acidophilus DSM 10332]
MHVDLHQDVWALNNSEGNHNREWLDDHKIWAVNIMGSPGAGKTTLLEHLLPILRKDFHVGVIEGDVATSK
DALRISALGIPVIQLETQGVCHLDGRMVRSGLRALEPLHLDLLFIENVGNLVCPADFFLGEHARLGVLST
VEGGDKIVKYPTLFRRIHALAITKTDLLPFTDFDMDQASKDFASLGARRPLFSLAKNEGISDLAQWIRNM
ALNVSTTEQDV